BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0888 (589 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 23 2.2 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 22 5.1 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 21 6.8 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 6.8 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 6.8 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 6.8 AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 21 9.0 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 21 9.0 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 21 9.0 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 23.0 bits (47), Expect = 2.2 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +2 Query: 47 C*TEQNVPENFIVFKKLIM 103 C TEQ+ PE I K L+M Sbjct: 1173 CQTEQDAPEAPIAIKALVM 1191 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 21.8 bits (44), Expect = 5.1 Identities = 12/36 (33%), Positives = 14/36 (38%) Frame = -2 Query: 378 LTHPT*PNMKIFQIMTSSFIICNFFLKAPEYCTYGH 271 LTH P I T + K P YC +GH Sbjct: 574 LTHKGKPIRMRIGIHTGMVLAGVVGKKMPRYCLFGH 609 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.4 bits (43), Expect = 6.8 Identities = 6/16 (37%), Positives = 9/16 (56%) Frame = -1 Query: 229 KWTSYPLGYHSHFTTW 182 +WT YP G ++ W Sbjct: 27 EWTKYPFGAEANTPGW 42 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.4 bits (43), Expect = 6.8 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 196 HFTTWYR*FDTLCGLRRKTDI 134 HF TWY+ L G R++++ Sbjct: 363 HFITWYKDGRQLPGTGRQSEL 383 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.4 bits (43), Expect = 6.8 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 196 HFTTWYR*FDTLCGLRRKTDI 134 HF TWY+ L G R++++ Sbjct: 363 HFITWYKDGRQLPGTGRQSEL 383 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.4 bits (43), Expect = 6.8 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 166 TLCGLRRKTDINGD 125 T C + RKT+++GD Sbjct: 717 TTCNMFRKTNLSGD 730 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 21.0 bits (42), Expect = 9.0 Identities = 6/21 (28%), Positives = 12/21 (57%) Frame = -3 Query: 65 RFVRSNSNEYNTETQSCVHNL 3 +++R + Y+T C+H L Sbjct: 320 QYIRHIKSPYHTPEPDCIHEL 340 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = +1 Query: 256 RFGFSMSICTIFGSLQEKVTNYER 327 RFG +S ++G+L K R Sbjct: 584 RFGVGVSFSAVYGALLTKTNRIAR 607 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = +1 Query: 256 RFGFSMSICTIFGSLQEKVTNYER 327 RFG +S ++G+L K R Sbjct: 674 RFGVGVSFSAVYGALLTKTNRIAR 697 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,132 Number of Sequences: 438 Number of extensions: 3917 Number of successful extensions: 9 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17115420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -