BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0880 (498 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK128446-1|BAC87444.1| 121|Homo sapiens protein ( Homo sapiens ... 31 2.2 >AK128446-1|BAC87444.1| 121|Homo sapiens protein ( Homo sapiens cDNA FLJ46589 fis, clone THYMU3044188. ). Length = 121 Score = 31.1 bits (67), Expect = 2.2 Identities = 17/55 (30%), Positives = 26/55 (47%) Frame = -1 Query: 252 LLLFISTFRTMGLQSFFNFLQFCSAGPLIQ*TLSVRLKKPFVTQDFRSIKAVIDW 88 L F+ + SFF+F F S+ PL LS L F+T+ + +A + W Sbjct: 16 LFSFLFFLSFLFFSSFFSFFYFLSSFPLFSFFLSFSLSFLFLTESYFVAQAGVQW 70 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 63,009,709 Number of Sequences: 237096 Number of extensions: 1137981 Number of successful extensions: 3218 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3129 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3216 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4536472160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -