BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0875 (761 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY047520-1|AAK77252.1| 367|Drosophila melanogaster GH02855p pro... 111 1e-24 AE014297-3727|AAF56405.2| 367|Drosophila melanogaster CG10238-P... 111 1e-24 >AY047520-1|AAK77252.1| 367|Drosophila melanogaster GH02855p protein. Length = 367 Score = 111 bits (266), Expect = 1e-24 Identities = 48/84 (57%), Positives = 62/84 (73%) Frame = +2 Query: 509 MDHIKLTVDRLSVEEISELVTDDSCGAISLFIGTTRDNFEGKKVLRLEYEAYESMAIKAI 688 MDH+KL D + + I +L+ D+ CGA S+F+GTTRDNF+GKKVL L YEAY+SMA+K + Sbjct: 1 MDHVKLVNDPIDIAHIHQLLADEGCGASSVFVGTTRDNFQGKKVLSLAYEAYDSMALKEM 60 Query: 689 KTICDDVRQKWPLVHGIAIYHRLG 760 IC D+R KW + I IYHRLG Sbjct: 61 NKICSDLRSKWLDLKHIVIYHRLG 84 >AE014297-3727|AAF56405.2| 367|Drosophila melanogaster CG10238-PA protein. Length = 367 Score = 111 bits (266), Expect = 1e-24 Identities = 48/84 (57%), Positives = 62/84 (73%) Frame = +2 Query: 509 MDHIKLTVDRLSVEEISELVTDDSCGAISLFIGTTRDNFEGKKVLRLEYEAYESMAIKAI 688 MDH+KL D + + I +L+ D+ CGA S+F+GTTRDNF+GKKVL L YEAY+SMA+K + Sbjct: 1 MDHVKLVNDPIDIAHIHQLLADEGCGASSVFVGTTRDNFQGKKVLSLAYEAYDSMALKEM 60 Query: 689 KTICDDVRQKWPLVHGIAIYHRLG 760 IC D+R KW + I IYHRLG Sbjct: 61 NKICSDLRSKWLDLKHIVIYHRLG 84 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 30,481,861 Number of Sequences: 53049 Number of extensions: 568888 Number of successful extensions: 1020 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 988 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1020 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3499501170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -