BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0874 (758 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855505-1|ABH88192.1| 119|Tribolium castaneum chemosensory pro... 22 4.6 EF127808-1|ABL67945.1| 311|Tribolium castaneum nicotinic acetyl... 22 6.1 EF127807-1|ABL67944.1| 311|Tribolium castaneum nicotinic acetyl... 22 6.1 EF127810-1|ABL67947.1| 311|Tribolium castaneum nicotinic acetyl... 21 8.1 EF127809-1|ABL67946.1| 311|Tribolium castaneum nicotinic acetyl... 21 8.1 EF127806-1|ABL67943.1| 311|Tribolium castaneum nicotinic acetyl... 21 8.1 >DQ855505-1|ABH88192.1| 119|Tribolium castaneum chemosensory protein 19 protein. Length = 119 Score = 22.2 bits (45), Expect = 4.6 Identities = 6/23 (26%), Positives = 13/23 (56%) Frame = +1 Query: 409 LILGNLWCHEYAERCQQRKIAQI 477 ++LG +WC +Y + + +I Sbjct: 9 MLLGAVWCEQYTTKYDNINVDEI 31 >EF127808-1|ABL67945.1| 311|Tribolium castaneum nicotinic acetylcholine receptor subunitalpha 6 transcript variant 3 protein. Length = 311 Score = 21.8 bits (44), Expect = 6.1 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = -1 Query: 698 VKMYHEALESRFGSYS*FVEFKKST*CSYVSFGLF 594 V MY+ A E G++ V K + C YV G+F Sbjct: 90 VLMYNSADEGFDGTFQTNVVVKHNGSCLYVPPGIF 124 >EF127807-1|ABL67944.1| 311|Tribolium castaneum nicotinic acetylcholine receptor subunitalpha 6 transcript variant 2 protein. Length = 311 Score = 21.8 bits (44), Expect = 6.1 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = -1 Query: 698 VKMYHEALESRFGSYS*FVEFKKST*CSYVSFGLF 594 V MY+ A E G++ V K + C YV G+F Sbjct: 90 VLMYNSADEGFDGTFQTNVVVKHNGSCLYVPPGIF 124 >EF127810-1|ABL67947.1| 311|Tribolium castaneum nicotinic acetylcholine receptor subunitalpha 6 transcript variant 5 protein. Length = 311 Score = 21.4 bits (43), Expect = 8.1 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = -1 Query: 698 VKMYHEALESRFGSYS*FVEFKKST*CSYVSFGLF 594 V MY+ A E G++ V K C YV G+F Sbjct: 90 VLMYNSADEGFDGTFQTNVVVKHGGSCLYVPPGIF 124 >EF127809-1|ABL67946.1| 311|Tribolium castaneum nicotinic acetylcholine receptor subunitalpha 6 transcript variant 4 protein. Length = 311 Score = 21.4 bits (43), Expect = 8.1 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = -1 Query: 698 VKMYHEALESRFGSYS*FVEFKKST*CSYVSFGLF 594 V MY+ A E G++ V K C YV G+F Sbjct: 90 VLMYNSADEGFDGTFQTNVVVKHGGSCLYVPPGIF 124 >EF127806-1|ABL67943.1| 311|Tribolium castaneum nicotinic acetylcholine receptor subunitalpha 6 transcript variant 1 protein. Length = 311 Score = 21.4 bits (43), Expect = 8.1 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = -1 Query: 698 VKMYHEALESRFGSYS*FVEFKKST*CSYVSFGLF 594 V MY+ A E G++ V K C YV G+F Sbjct: 90 VLMYNSADEGFDGTFQTNVVVKHGGSCLYVPPGIF 124 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,662 Number of Sequences: 336 Number of extensions: 3788 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20338724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -