BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0874 (758 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ459959-1|CAD31058.1| 462|Anopheles gambiae dopachrome convers... 51 4e-08 DQ974172-1|ABJ52812.1| 409|Anopheles gambiae serpin 13 protein. 25 3.3 AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CY... 25 3.3 AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 24 4.4 >AJ459959-1|CAD31058.1| 462|Anopheles gambiae dopachrome conversion enzyme protein. Length = 462 Score = 50.8 bits (116), Expect = 4e-08 Identities = 33/110 (30%), Positives = 57/110 (51%), Gaps = 1/110 (0%) Frame = +3 Query: 51 PNANVGKELISVFTMVEAICSRIWFVDTGYLDIPGIRKQVKPASLLLFNKYEEQPQFRKD 230 P+AN +++V+ C R+WFVDTG ++IPG V+ S+ + +P R + Sbjct: 112 PDAN---RIVTVYRPRVDRCDRLWFVDTGMMEIPGNFTVVQRPSVWSIDLNTNEPIHRFE 168 Query: 231 IDNAFLHNGITSGLRSLSVDF-ILPCSESYVYITDDTTRDLIVFSLQDFR 377 I + G GL S+++D C + +VYI+D T ++V+ + R Sbjct: 169 IPKEAVETGY--GLTSITLDVDPSDCEKVFVYISDLQTYRMVVYDYANRR 216 >DQ974172-1|ABJ52812.1| 409|Anopheles gambiae serpin 13 protein. Length = 409 Score = 24.6 bits (51), Expect = 3.3 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +2 Query: 455 NSAKSRRLQQKSLSSYTYFRRSMQTNSFCFCG 550 N A LQ S S+ Y +QT+SF CG Sbjct: 288 NVANFNGLQDSSTSNL-YLSEILQTDSFAMCG 318 >AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CYP12F2 protein. Length = 522 Score = 24.6 bits (51), Expect = 3.3 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -2 Query: 256 PLWRKALSMSFLNCGCSSYLLKSSNDA 176 PLW+ L S L CG +S L S+ A Sbjct: 7 PLWQHWLRSSVLPCGTTSNRLLSAQPA 33 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 24.2 bits (50), Expect = 4.4 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = +3 Query: 291 FILPCSE-SYVYITDDTTRDLIVFSLQDFRFTKISR 395 FI P + SY+ +T + RDL VF T++S+ Sbjct: 171 FICPLARLSYLNLTQNRLRDLSVFHFSASLSTRLSK 206 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 783,111 Number of Sequences: 2352 Number of extensions: 15689 Number of successful extensions: 27 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78586767 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -