BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0873 (787 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_22206| Best HMM Match : 7tm_1 (HMM E-Value=1.8e-38) 32 0.61 SB_6260| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 >SB_22206| Best HMM Match : 7tm_1 (HMM E-Value=1.8e-38) Length = 362 Score = 31.9 bits (69), Expect = 0.61 Identities = 17/41 (41%), Positives = 23/41 (56%) Frame = +2 Query: 341 YEVGVFFFAYRFSFCIVTYSYCDRNMETKVIYP*SLHRPIT 463 Y +G FAY F+FC VTY DR +++P S H +T Sbjct: 103 YVIGYILFAYMFNFCGVTY---DRYQ--AIVHPLSYHAKMT 138 >SB_6260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 600 Score = 27.9 bits (59), Expect = 9.9 Identities = 21/57 (36%), Positives = 23/57 (40%), Gaps = 5/57 (8%) Frame = -1 Query: 391 YNAKGKSICKKKYPDFISQGRWCH*LYLQVPSFFIAFVGRRT-----YGPPDGEWLP 236 YN KGK KK FI G W L +P F + Y PPD WLP Sbjct: 195 YNDKGKMSIKKLRYIFI--GVWLGAAVLNLPLFLTIYYEASKHFCFEYWPPDLPWLP 249 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,943,283 Number of Sequences: 59808 Number of extensions: 438387 Number of successful extensions: 815 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 739 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 801 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2155861620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -