BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0873 (787 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC109082-1|AAI09083.1| 70|Homo sapiens Unknown (protein for MG... 31 6.2 BC109081-1|AAI09082.1| 70|Homo sapiens microRNA host gene (non... 31 6.2 AB176708-1|BAD18387.1| 70|Homo sapiens C13orf25 v_2 protein. 31 6.2 >BC109082-1|AAI09083.1| 70|Homo sapiens Unknown (protein for MGC:126270) protein. Length = 70 Score = 30.7 bits (66), Expect = 6.2 Identities = 18/53 (33%), Positives = 27/53 (50%) Frame = -3 Query: 413 FCHSSYTLQCKRKIYMQKKIPRLHISRSVVSLTLSTGTLFFYCLCRQTNIRPA 255 FCH + KR Y K+P L++ + V+ S LFF+ +C+ RPA Sbjct: 2 FCHVDVKISSKR--YTWTKLP-LNVPKLVLIYLQSHFVLFFFSMCQSIWERPA 51 >BC109081-1|AAI09082.1| 70|Homo sapiens microRNA host gene (non-protein coding) 1 protein. Length = 70 Score = 30.7 bits (66), Expect = 6.2 Identities = 18/53 (33%), Positives = 27/53 (50%) Frame = -3 Query: 413 FCHSSYTLQCKRKIYMQKKIPRLHISRSVVSLTLSTGTLFFYCLCRQTNIRPA 255 FCH + KR Y K+P L++ + V+ S LFF+ +C+ RPA Sbjct: 2 FCHVDVKISSKR--YTWTKLP-LNVPKLVLIYLQSHFVLFFFSMCQSIWERPA 51 >AB176708-1|BAD18387.1| 70|Homo sapiens C13orf25 v_2 protein. Length = 70 Score = 30.7 bits (66), Expect = 6.2 Identities = 18/53 (33%), Positives = 27/53 (50%) Frame = -3 Query: 413 FCHSSYTLQCKRKIYMQKKIPRLHISRSVVSLTLSTGTLFFYCLCRQTNIRPA 255 FCH + KR Y K+P L++ + V+ S LFF+ +C+ RPA Sbjct: 2 FCHVDVKISSKR--YTWTKLP-LNVPKLVLIYLQSHFVLFFFSMCQSIWERPA 51 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 101,157,090 Number of Sequences: 237096 Number of extensions: 2009394 Number of successful extensions: 2900 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2819 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2900 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9590293096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -