BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0873 (787 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT010250-1|AAQ23568.1| 474|Drosophila melanogaster RE37138p pro... 29 9.5 AE014296-1045|AAF50718.2| 474|Drosophila melanogaster CG32406-P... 29 9.5 >BT010250-1|AAQ23568.1| 474|Drosophila melanogaster RE37138p protein. Length = 474 Score = 28.7 bits (61), Expect = 9.5 Identities = 18/60 (30%), Positives = 30/60 (50%) Frame = +3 Query: 78 NLEINRSVYLSTNQTSNVHS*YINYFNLFERVLRS*VGSGLALPLALLKSMGDGNHSPSG 257 N INR++ + N SN +S +YFN F+ + + + + L A +S N P+G Sbjct: 73 NANINRNLNQNPNSNSNTNS--NSYFNRFDNRIAANLAAVLTGAGARFRSSSCSNRHPAG 130 >AE014296-1045|AAF50718.2| 474|Drosophila melanogaster CG32406-PA protein. Length = 474 Score = 28.7 bits (61), Expect = 9.5 Identities = 18/60 (30%), Positives = 30/60 (50%) Frame = +3 Query: 78 NLEINRSVYLSTNQTSNVHS*YINYFNLFERVLRS*VGSGLALPLALLKSMGDGNHSPSG 257 N INR++ + N SN +S +YFN F+ + + + + L A +S N P+G Sbjct: 73 NANINRNLNQNPNSNSNTNS--NSYFNRFDNRIAANLAAVLTGAGARFRSSSCSNRHPAG 130 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 31,689,914 Number of Sequences: 53049 Number of extensions: 647398 Number of successful extensions: 1236 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1208 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1236 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 3634208604 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -