BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0873 (787 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z75546-8|CAC42331.2| 640|Caenorhabditis elegans Hypothetical pr... 31 0.71 >Z75546-8|CAC42331.2| 640|Caenorhabditis elegans Hypothetical protein R05D11.9 protein. Length = 640 Score = 31.5 bits (68), Expect = 0.71 Identities = 18/63 (28%), Positives = 31/63 (49%), Gaps = 1/63 (1%) Frame = -1 Query: 571 LIYNAIN-ATKSLALNKLSHRHHVHTIKINLKQTRVACDWSMEGSRVDNFSLHISVTVAI 395 L+ N N TKS + ++ + + I+ LKQ V C +S VDN+ L + + Sbjct: 192 LVQNFCNFVTKSCTTAQFTNANKLLLIRYLLKQFHVFCQFSTGDPEVDNWKLDLMASAPF 251 Query: 394 RYN 386 R++ Sbjct: 252 RFS 254 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,834,372 Number of Sequences: 27780 Number of extensions: 351664 Number of successful extensions: 743 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 689 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 743 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1903721438 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -