BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0871 (771 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17617| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_57691| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_6465| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_2383| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_27342| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_58054| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 6e-09 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_33624| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_59794| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_6881| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_26327| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_1546| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_13730| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_25244| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_18079| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.016 SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.063 SB_15948| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.78 SB_492| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_12062| Best HMM Match : NUC129 (HMM E-Value=9.2) 29 3.1 SB_51316| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_50608| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_13633| Best HMM Match : Glyco_hydro_31 (HMM E-Value=0) 29 5.5 SB_34251| Best HMM Match : FA_hydroxylase (HMM E-Value=5.5) 29 5.5 SB_35396| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 SB_24390| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) 28 9.6 >SB_17617| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 67.3 bits (157), Expect = 1e-11 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = -1 Query: 126 SWIVARRTSAKAFAKGVFINQERKLEVRRRLDTALVLTVN 7 SWI RRT+AKAFAK VFINQERKLE RRR DT LVLT+N Sbjct: 4 SWIYERRTTAKAFAKNVFINQERKLEDRRRSDTVLVLTIN 43 >SB_57691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 60.5 bits (140), Expect = 1e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -1 Query: 111 RRTSAKAFAKGVFINQERKLEVRRRLDTALVLTVN 7 RRT+AKAFAK VFINQERKLE RRR DT LVLT+N Sbjct: 9 RRTTAKAFAKNVFINQERKLEDRRRSDTVLVLTIN 43 >SB_6465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 60.5 bits (140), Expect = 1e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -1 Query: 111 RRTSAKAFAKGVFINQERKLEVRRRLDTALVLTVN 7 RRT+AKAFAK VFINQERKLE RRR DT LVLT+N Sbjct: 9 RRTTAKAFAKNVFINQERKLEDRRRSDTVLVLTIN 43 >SB_2383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 60.5 bits (140), Expect = 1e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -1 Query: 111 RRTSAKAFAKGVFINQERKLEVRRRLDTALVLTVN 7 RRT+AKAFAK VFINQERKLE RRR DT LVLT+N Sbjct: 9 RRTTAKAFAKNVFINQERKLEDRRRSDTVLVLTIN 43 >SB_27342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 48 Score = 60.5 bits (140), Expect = 1e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -1 Query: 111 RRTSAKAFAKGVFINQERKLEVRRRLDTALVLTVN 7 RRT+AKAFAK VFINQERKLE RRR DT LVLT+N Sbjct: 11 RRTTAKAFAKNVFINQERKLEDRRRSDTVLVLTIN 45 >SB_58054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 58.4 bits (135), Expect = 6e-09 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -1 Query: 108 RTSAKAFAKGVFINQERKLEVRRRLDTALVLTVN 7 RT+AKAFAK VFINQERKLE RRR DT LVLT+N Sbjct: 29 RTTAKAFAKNVFINQERKLEDRRRSDTVLVLTIN 62 >SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 48.0 bits (109), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 108 RTSAKAFAKGVFINQERKLEVRRRLDT 28 RT+AKAFAK VFINQERKLE RRR DT Sbjct: 2 RTTAKAFAKNVFINQERKLEDRRRSDT 28 >SB_33624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 48.0 bits (109), Expect = 8e-06 Identities = 24/36 (66%), Positives = 29/36 (80%), Gaps = 1/36 (2%) Frame = -1 Query: 111 RRTS-AKAFAKGVFINQERKLEVRRRLDTALVLTVN 7 R+T+ ++ AK VFINQERKLE RRR DT LVLT+N Sbjct: 8 RKTNYCESIAKNVFINQERKLEDRRRSDTVLVLTIN 43 Score = 29.5 bits (63), Expect = 3.1 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -3 Query: 133 VKFLDRRKTNISESICQRCFHQSRTKV 53 VKFLD RKTN ESI + F K+ Sbjct: 2 VKFLDLRKTNYCESIAKNVFINQERKL 28 >SB_59794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = +1 Query: 676 DVVAVSQAPSPESNPDSPLPVTTM 747 DVVAVSQAPSPESNP+SP PV TM Sbjct: 105 DVVAVSQAPSPESNPNSPSPVVTM 128 >SB_6881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.4 bits (100), Expect = 1e-04 Identities = 22/36 (61%), Positives = 28/36 (77%), Gaps = 1/36 (2%) Frame = -1 Query: 111 RRTS-AKAFAKGVFINQERKLEVRRRLDTALVLTVN 7 R+T+ ++ + VFINQERKLE RRR DT LVLT+N Sbjct: 8 RKTNYCESICQDVFINQERKLEDRRRSDTVLVLTIN 43 Score = 33.9 bits (74), Expect = 0.15 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -3 Query: 133 VKFLDRRKTNISESICQRCFHQSRTKV 53 VKFLD RKTN ESICQ F K+ Sbjct: 2 VKFLDLRKTNYCESICQDVFINQERKL 28 >SB_26327| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 41.9 bits (94), Expect = 6e-04 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 1/36 (2%) Frame = -1 Query: 111 RRTS-AKAFAKGVFINQERKLEVRRRLDTALVLTVN 7 R+T+ ++ + FINQERKLE RRR DT LVLT+N Sbjct: 8 RKTNYCESICQECFINQERKLEDRRRSDTVLVLTIN 43 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -3 Query: 130 KFLDRRKTNISESICQRCFHQSRTKV 53 + L RKTN ESICQ CF K+ Sbjct: 3 EILGFRKTNYCESICQECFINQERKL 28 >SB_1546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 41.9 bits (94), Expect = 6e-04 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 1/36 (2%) Frame = -1 Query: 111 RRTS-AKAFAKGVFINQERKLEVRRRLDTALVLTVN 7 R+T+ ++ + FINQERKLE RRR DT LVLT+N Sbjct: 8 RKTNYCESICQECFINQERKLEDRRRSDTVLVLTIN 43 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -3 Query: 133 VKFLDRRKTNISESICQRCFHQSRTKV 53 VKFLD RKTN ESICQ CF K+ Sbjct: 2 VKFLDLRKTNYCESICQECFINQERKL 28 >SB_13730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 41.9 bits (94), Expect = 6e-04 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 1/36 (2%) Frame = -1 Query: 111 RRTS-AKAFAKGVFINQERKLEVRRRLDTALVLTVN 7 R+T+ ++ + FINQERKLE RRR DT LVLT+N Sbjct: 8 RKTNYCESICQECFINQERKLEDRRRSDTVLVLTIN 43 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -3 Query: 133 VKFLDRRKTNISESICQRCFHQSRTKV 53 VKFLD RKTN ESICQ CF K+ Sbjct: 2 VKFLDLRKTNYCESICQECFINQERKL 28 >SB_25244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = +1 Query: 685 AVSQAPSPESNPDSPLPVTTM 747 AVSQAPSPESNP+SP PV TM Sbjct: 52 AVSQAPSPESNPNSPSPVVTM 72 >SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 39.9 bits (89), Expect = 0.002 Identities = 23/59 (38%), Positives = 30/59 (50%) Frame = -2 Query: 602 TLTRPRNRNEYTLNILTRNNWRASLXXXXXXXXXXXAYTKIVAVKKLVVAFVRRAVGAP 426 T + R ++++ R +WRASL AY K+VAVKKLVV F VG P Sbjct: 44 TCQQTTTRVHAAMHLVIRIHWRASLVPAAAVIPAPIAYIKVVAVKKLVVGFRDGTVGPP 102 >SB_18079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 37.1 bits (82), Expect = 0.016 Identities = 21/42 (50%), Positives = 23/42 (54%) Frame = -2 Query: 551 RNNWRASLXXXXXXXXXXXAYTKIVAVKKLVVAFVRRAVGAP 426 R +WRASL AY K+VAVKKLVV F VG P Sbjct: 14 RIHWRASLVPAAAVIPAPIAYIKVVAVKKLVVGFRDGTVGPP 55 >SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 35.1 bits (77), Expect = 0.063 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +2 Query: 686 PFLRLPLRNRTLIPRYP 736 PFLRLPLRNRTLI R+P Sbjct: 224 PFLRLPLRNRTLILRHP 240 >SB_15948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 0.78 Identities = 19/38 (50%), Positives = 20/38 (52%) Frame = -2 Query: 539 RASLXXXXXXXXXXXAYTKIVAVKKLVVAFVRRAVGAP 426 RASL AY K+VAVKKLVV F VG P Sbjct: 5 RASLVPAAAVIPAPIAYIKVVAVKKLVVGFRDGTVGPP 42 >SB_492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 29.9 bits (64), Expect = 2.4 Identities = 19/42 (45%), Positives = 20/42 (47%) Frame = -2 Query: 551 RNNWRASLXXXXXXXXXXXAYTKIVAVKKLVVAFVRRAVGAP 426 R ASL AY K+VAVKKLVV F VG P Sbjct: 24 RERRAASLVPAAAVIPAPIAYIKVVAVKKLVVGFRDGTVGPP 65 >SB_12062| Best HMM Match : NUC129 (HMM E-Value=9.2) Length = 111 Score = 29.5 bits (63), Expect = 3.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = -2 Query: 491 YTKIVAVKKLVVAFVRRAVGAP 426 Y K+VAVKKLVV F VG P Sbjct: 88 YIKVVAVKKLVVGFRDGTVGPP 109 >SB_51316| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 29.5 bits (63), Expect = 3.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = -2 Query: 491 YTKIVAVKKLVVAFVRRAVGAP 426 Y K+VAVKKLVV F VG P Sbjct: 89 YIKVVAVKKLVVGFRDGTVGPP 110 >SB_50608| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 40 Score = 29.5 bits (63), Expect = 3.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = -2 Query: 491 YTKIVAVKKLVVAFVRRAVGAP 426 Y K+VAVKKLVV F VG P Sbjct: 17 YIKVVAVKKLVVGFRDGTVGPP 38 >SB_13633| Best HMM Match : Glyco_hydro_31 (HMM E-Value=0) Length = 663 Score = 28.7 bits (61), Expect = 5.5 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Frame = +1 Query: 241 RNIQAAFLARFEHSNLFK--VKLSAHLDTHRRAPR*DFDIEPAFFRTPAHRRYA 396 +N + LAR+ + +F ++ AHLDT RR P D+ R RYA Sbjct: 573 KNPEPELLARWYQTGVFTPFLRAHAHLDTKRREPWLFDDVYKNVIRDALRTRYA 626 >SB_34251| Best HMM Match : FA_hydroxylase (HMM E-Value=5.5) Length = 203 Score = 28.7 bits (61), Expect = 5.5 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = +3 Query: 453 CNYELFNRNNFSIRYWSWNYRGCWH 527 C + RN +RYW W R C H Sbjct: 91 CEVTVIARNILPVRYWIWLSRKCGH 115 >SB_35396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 53 Score = 28.3 bits (60), Expect = 7.3 Identities = 13/38 (34%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = -2 Query: 194 QNSEVMINRDNWGHSY-CDVRGEILGSSQDEHQRKHLP 84 Q EV +++ GH Y C GE++ S++D H+ +P Sbjct: 7 QCKEVESSKEILGHPYVCAFAGEVIQSTEDVHKPSWIP 44 >SB_24390| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 28.3 bits (60), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +3 Query: 390 ICSANVSVSPRMRCTDSAAHKCNYELFNRNNFSIRYW-SWNY 512 I S S R+RCT S + KC + + F W S+NY Sbjct: 139 ISSGYYGRSYRLRCTSSTSWKCRLTSISESYFKGNNWFSYNY 180 >SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) Length = 441 Score = 27.9 bits (59), Expect = 9.6 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +1 Query: 667 PSLDVVAVSQAPSPESNPDSPLP 735 P+ DV+A Q P P S D PLP Sbjct: 75 PAEDVMAAHQEPKPTSAIDQPLP 97 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,400,160 Number of Sequences: 59808 Number of extensions: 498417 Number of successful extensions: 1434 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 1252 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1434 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2095976575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -