BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0871 (771 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g17920.1 68416.m02282 leucine-rich repeat family protein cont... 29 4.5 At4g10890.1 68417.m01772 expressed protein 28 7.9 >At3g17920.1 68416.m02282 leucine-rich repeat family protein contains leucine rich repeat (LRR) domains, Pfam:PF00560 Length = 962 Score = 28.7 bits (61), Expect = 4.5 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = +1 Query: 658 RLLPSLDVVAVSQAPSPESNPDSPLPVTTMVVAE 759 RLLPSL VV+ +P+ + P S LP + + V E Sbjct: 84 RLLPSLKVVSSLPSPARDPTPLSLLPFSKLKVLE 117 >At4g10890.1 68417.m01772 expressed protein Length = 527 Score = 27.9 bits (59), Expect = 7.9 Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = -3 Query: 115 RKTNISESICQRCFHQS-RTKVRGSKAIRYRPSSNRKYV 2 ++T I +C RC+H S R K+R S R S++ + Sbjct: 194 KQTKICSRVCSRCYHYSMRQKLRHSLHTRILKSNSENAI 232 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,098,114 Number of Sequences: 28952 Number of extensions: 337030 Number of successful extensions: 792 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 764 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 792 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1716774400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -