BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0870 (851 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-9|CAD27760.1| 348|Anopheles gambiae putative translati... 25 2.2 AY324307-1|AAQ89692.1| 154|Anopheles gambiae insulin-like pepti... 25 2.9 >AJ439060-9|CAD27760.1| 348|Anopheles gambiae putative translation initiation factor protein. Length = 348 Score = 25.4 bits (53), Expect = 2.2 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = -2 Query: 763 AISYTAVRDLSNSGATNINFVNIFIRTID*QLCSP*HC 650 AI Y +D+S++ A N N+ ++ +D L HC Sbjct: 124 AIEYMLEKDISDNRAIGDNGANVLVKGVDRPLKLLTHC 161 >AY324307-1|AAQ89692.1| 154|Anopheles gambiae insulin-like peptide 1 precursor protein. Length = 154 Score = 25.0 bits (52), Expect = 2.9 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = -3 Query: 642 HLFPLSSCHTSISLLIVLIEQLSGMD 565 HL + SC T++ LL+VL+ +SG+D Sbjct: 8 HLLLVVSCGTALLLLLVLL-SVSGVD 32 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 819,354 Number of Sequences: 2352 Number of extensions: 16452 Number of successful extensions: 22 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 90545769 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -