BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0869 (820 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A7S186 Cluster: Predicted protein; n=1; Nematostella ve... 36 0.93 >UniRef50_A7S186 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 465 Score = 36.3 bits (80), Expect = 0.93 Identities = 24/83 (28%), Positives = 35/83 (42%) Frame = -1 Query: 424 EETETMLLLNKTKKIPSRSTNSQ*SNTKPAVVICHLLKVQNLDLFNKNTSARRGYVLEMV 245 E ET LL IP + ++ + LKV+ DLF +A +GY L Sbjct: 360 ELDETKALLESCLTIPLEEADCSRGDSVLYATDSNKLKVELCDLFESYQTAAKGYNLRRH 419 Query: 244 GSVTLFLYNFFFRISANHLLVPY 176 S+ FL N + +LL+ Y Sbjct: 420 PSIRAFLLNAVYNSPEENLLISY 442 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 660,387,884 Number of Sequences: 1657284 Number of extensions: 11873947 Number of successful extensions: 22453 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 21618 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22447 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 71200899835 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -