BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0869 (820 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48676| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_53769| Best HMM Match : Hepcidin (HMM E-Value=4.7) 30 2.6 SB_27831| Best HMM Match : Neur_chan_LBD (HMM E-Value=2.6e-11) 30 2.6 >SB_48676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 453 Score = 36.3 bits (80), Expect = 0.030 Identities = 24/83 (28%), Positives = 35/83 (42%) Frame = -1 Query: 424 EETETMLLLNKTKKIPSRSTNSQ*SNTKPAVVICHLLKVQNLDLFNKNTSARRGYVLEMV 245 E ET LL IP + ++ + LKV+ DLF +A +GY L Sbjct: 348 ELDETKALLESCLTIPLEEADCSRGDSVLYATDSNKLKVELCDLFESYQTAAKGYNLRRH 407 Query: 244 GSVTLFLYNFFFRISANHLLVPY 176 S+ FL N + +LL+ Y Sbjct: 408 PSIRAFLLNAVYNSPEENLLISY 430 >SB_53769| Best HMM Match : Hepcidin (HMM E-Value=4.7) Length = 106 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/45 (31%), Positives = 20/45 (44%), Gaps = 3/45 (6%) Frame = -2 Query: 264 DMSWKWSEALRCSYIIFSSEFLLITYWSLTI---KIRLCYHKYYK 139 D W+ AL C YI+F I WS + +R C+ +K Sbjct: 62 DTGWETGLALNCIYIVFVLTEAAIAIWSAELCRRSVRCCFQNGFK 106 >SB_27831| Best HMM Match : Neur_chan_LBD (HMM E-Value=2.6e-11) Length = 350 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/66 (24%), Positives = 33/66 (50%), Gaps = 4/66 (6%) Frame = -2 Query: 267 EDMSWKWSEALRCSYIIFSSEFLLITYWSLTIKIRLCYHKYYKISH----FKFKEKKIYA 100 ED+ ++W + + I+ +E T ++ K++ + + S FKF+ + +Y Sbjct: 107 EDLMYEWKKPVGSDVFIYDAEMAQFTVVNVKRKLKHPLYHSRRFSGMTVTFKFQRRTMYY 166 Query: 99 IYQNYI 82 I+Q YI Sbjct: 167 IFQMYI 172 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,013,049 Number of Sequences: 59808 Number of extensions: 352956 Number of successful extensions: 506 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 486 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 505 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2287608719 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -