BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0869 (820 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 25 2.1 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 25 2.1 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 25.4 bits (53), Expect = 2.1 Identities = 17/70 (24%), Positives = 30/70 (42%) Frame = -1 Query: 430 HMEETETMLLLNKTKKIPSRSTNSQ*SNTKPAVVICHLLKVQNLDLFNKNTSARRGYVLE 251 +M+E + + LN TK +T + + P V + L + + +++A YVL Sbjct: 560 YMKEHKDTVALNTTKLSTMMTTTTTTTEPPPIVQVIGLPAPTPRNNYKPSSAAAAPYVLP 619 Query: 250 MVGSVTLFLY 221 V F Y Sbjct: 620 RASEVNDFFY 629 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 25.4 bits (53), Expect = 2.1 Identities = 17/70 (24%), Positives = 30/70 (42%) Frame = -1 Query: 430 HMEETETMLLLNKTKKIPSRSTNSQ*SNTKPAVVICHLLKVQNLDLFNKNTSARRGYVLE 251 +M+E + + LN TK +T + + P V + L + + +++A YVL Sbjct: 559 YMKEHKDTVALNTTKLSTMMTTTTTTTEPPPIVQVIGLPAPTPRNNYKPSSAAAAPYVLP 618 Query: 250 MVGSVTLFLY 221 V F Y Sbjct: 619 RASEVNDFFY 628 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 715,489 Number of Sequences: 2352 Number of extensions: 12930 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 86902827 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -