BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0869 (820 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g02650.1 68416.m00256 pentatricopeptide (PPR) repeat-containi... 29 3.7 At5g20470.1 68418.m02433 myosin, putative similar to PIR|T00727 ... 29 4.9 >At3g02650.1 68416.m00256 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 1077 Score = 29.1 bits (62), Expect = 3.7 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -2 Query: 237 LRCSYIIFSSEFLLITYWSLTIKIRLCYHKY 145 +R Y F L+ S+ IKIR CYHKY Sbjct: 91 IRNQYNSFRFHDLVEKLQSMEIKIRACYHKY 121 >At5g20470.1 68418.m02433 myosin, putative similar to PIR|T00727 myosin heavy chain PCR43 [Arabidopsis thaliana] Length = 556 Score = 28.7 bits (61), Expect = 4.9 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +1 Query: 301 DFVLSINDILPQLASCLIIVSS*TEMVFFLFCLV 402 D VL + + P+ CL IV +++ F FCL+ Sbjct: 4 DMVLLVREPKPEFRLCLYIVFDFIQILIFFFCLM 37 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,212,125 Number of Sequences: 28952 Number of extensions: 249209 Number of successful extensions: 403 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 399 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 403 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1872844800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -