BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0867 (767 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 29 0.21 DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. 25 2.6 AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 25 3.4 AY496421-1|AAS80138.1| 439|Anopheles gambiae bacteria responsiv... 24 4.5 AY070254-1|AAL59653.1| 225|Anopheles gambiae glutathione S-tran... 24 5.9 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 28.7 bits (61), Expect = 0.21 Identities = 13/50 (26%), Positives = 23/50 (46%) Frame = +3 Query: 606 GSSTLKLRSLQVQPVKVQMNYYHKQRSQLMTSQHQQEDQWMISHLKQKAH 755 G T + +Q+QP++ + Q Q + Q QQ+ Q H + + H Sbjct: 1279 GMPTHQHSQIQLQPIQQPLQTLQHQYQQQLQQQQQQQQQQQQQHQQHQQH 1328 Score = 25.8 bits (54), Expect = 1.5 Identities = 14/48 (29%), Positives = 23/48 (47%) Frame = +3 Query: 612 STLKLRSLQVQPVKVQMNYYHKQRSQLMTSQHQQEDQWMISHLKQKAH 755 S ++L+ +Q QP++ + Y +Q Q Q QQ+ Q Q H Sbjct: 1286 SQIQLQPIQ-QPLQTLQHQYQQQLQQQQQQQQQQQQQHQQHQQHQLQH 1332 >DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. Length = 847 Score = 25.0 bits (52), Expect = 2.6 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +2 Query: 278 VSSKWFFPRWAQALI 322 V K+FFP+W Q L+ Sbjct: 672 VLDKYFFPKWLQTLV 686 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 24.6 bits (51), Expect = 3.4 Identities = 13/42 (30%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = +3 Query: 627 RSLQVQPVKVQMNYYHKQRSQLMTSQH-QQEDQWMISHLKQK 749 R Q Q + Q +Q+ Q QH QQ+ QW +Q+ Sbjct: 336 RQQQQQQQQQQRQQQQRQQQQQQQQQHQQQQQQWQQQQQQQQ 377 >AY496421-1|AAS80138.1| 439|Anopheles gambiae bacteria responsive protein 2 protein. Length = 439 Score = 24.2 bits (50), Expect = 4.5 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +2 Query: 194 PNPMNPAVIGTDVVERKVVD 253 PNP N A+ G D RKV D Sbjct: 345 PNPSNTALKGADAPLRKVGD 364 >AY070254-1|AAL59653.1| 225|Anopheles gambiae glutathione S-transferase E4 protein. Length = 225 Score = 23.8 bits (49), Expect = 5.9 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 188 KYPNPMNPAVIGTDVVERKVVDGVLH 265 KY P ++ +DVV+R V+ LH Sbjct: 78 KYGKPEGDSLYPSDVVQRAKVNAALH 103 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 814,853 Number of Sequences: 2352 Number of extensions: 17502 Number of successful extensions: 33 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79834176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -