BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0865 (818 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Triboliu... 24 1.7 EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 23 3.9 AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 22 5.1 >S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Tribolium castaneum homeodomainprotein mRNA, complete cds. ). Length = 327 Score = 23.8 bits (49), Expect = 1.7 Identities = 20/79 (25%), Positives = 37/79 (46%), Gaps = 1/79 (1%) Frame = +3 Query: 126 SLQAAKNQTMVLHIMG-EEITGTGNLGDTIFTIHLASMNIGIGPIFMHMT*TSDRNSMGI 302 +++ K +T+V + G EE G +L + S + + P +++ T SDR S G Sbjct: 149 NIRKCKPKTVVPEVGGVEEAKGPVDLSKSEPEKKTESQPM-LWPAWVYCTRYSDRPSSGR 207 Query: 303 DLTDKRPQPPGLRTSKPAS 359 +R + PG + P + Sbjct: 208 SPRTRRVKKPGAKQGAPTA 226 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 22.6 bits (46), Expect = 3.9 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = +1 Query: 622 CLCFKRSHI*KSIGNPLCSDV 684 C K + K IGNP+C + Sbjct: 311 CAATKNPNFDKMIGNPICVQI 331 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 22.2 bits (45), Expect = 5.1 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +2 Query: 158 ATHYGGGNHRNWQPWGHN 211 A GGN+ N P GH+ Sbjct: 182 AAQVSGGNNNNGTPGGHS 199 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 214,511 Number of Sequences: 336 Number of extensions: 5169 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22414104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -