BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0865 (818 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-h... 25 2.1 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 25 2.8 >AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-helix transcriptionfactor ASH protein. Length = 371 Score = 25.4 bits (53), Expect = 2.1 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = +2 Query: 206 HNFHYPSGQHEHRYRPNFHAYDLNLRPEFNGN 301 H+ H P QH+ +Y + H + + E + N Sbjct: 313 HHQHQPQQQHQQQYHSHPHHTPVQFKTELHDN 344 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 25.0 bits (52), Expect = 2.8 Identities = 20/79 (25%), Positives = 32/79 (40%), Gaps = 3/79 (3%) Frame = +2 Query: 401 TNNET-YNNLGRLMCAQQCGVVVEIQRKSTCSAANVPTESSTSFDRGDG--LLQTTDVPA 571 + NET Y++ +LM + G + E+ T A + S G +L + P Sbjct: 1105 SENETEYSSSDQLMGGGKPGPLKEVNGVVTRKGAPMKFGPGVSGPGGSKTPILNRKEKPK 1164 Query: 572 NIQQCISLCPQSEETRPVC 628 + C + P T PVC Sbjct: 1165 SCSVCRQISPTVNSTEPVC 1183 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 970,434 Number of Sequences: 2352 Number of extensions: 22797 Number of successful extensions: 43 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 40 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 43 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 86902827 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -