BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0861 (820 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ697720-1|CAG26913.1| 207|Anopheles gambiae putative odorant-b... 27 0.69 AY578808-1|AAT07313.1| 458|Anopheles gambiae saxophone protein. 25 2.8 CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase ... 25 3.7 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 24 6.5 L76038-1|AAC27383.1| 683|Anopheles gambiae prophenoloxidase pro... 23 8.6 AF031626-1|AAD01936.1| 683|Anopheles gambiae prophenoloxidase p... 23 8.6 >AJ697720-1|CAG26913.1| 207|Anopheles gambiae putative odorant-binding protein OBPjj10 protein. Length = 207 Score = 27.1 bits (57), Expect = 0.69 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -1 Query: 412 LTEEFFGFTFIKFQPCFLD 356 L++EFFG + F CFLD Sbjct: 111 LSKEFFGLVMVCFVKCFLD 129 >AY578808-1|AAT07313.1| 458|Anopheles gambiae saxophone protein. Length = 458 Score = 25.0 bits (52), Expect = 2.8 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = -2 Query: 267 APRDKQSKRSFSRGSVACVIARALFCISSSSWTEPADIG 151 A RD ++K R + CVIA + S T DIG Sbjct: 276 AHRDLKTKNILIRANGTCVIADFGLAVMHSQTTNKIDIG 314 >CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase protein. Length = 562 Score = 24.6 bits (51), Expect = 3.7 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = -2 Query: 741 VVVNGDTDATVVVHELFKSTLPHRLFHRTQNSRGTSFI 628 V + G++ V VH L S LFH+ GT+ + Sbjct: 197 VTIFGESAGGVAVHYLVLSNKASGLFHKAIAQSGTALV 234 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.8 bits (49), Expect = 6.5 Identities = 12/37 (32%), Positives = 23/37 (62%), Gaps = 2/37 (5%) Frame = +3 Query: 342 NSFMASRKQGWNLIKVKPKNSSVNSTQTV--VAQSVL 446 ++ ++ G + ++KPK + VNS+ T VA+S+L Sbjct: 1682 HTVLSGPNDGSSQTEMKPKQNCVNSSNTYNHVAESIL 1718 >L76038-1|AAC27383.1| 683|Anopheles gambiae prophenoloxidase protein. Length = 683 Score = 23.4 bits (48), Expect = 8.6 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +2 Query: 437 ISLDEFLIKIRPPMSESRRNIVE 505 I LD+FL+ +RP + RR E Sbjct: 526 IELDKFLVALRPGANRIRRRSKE 548 >AF031626-1|AAD01936.1| 683|Anopheles gambiae prophenoloxidase protein. Length = 683 Score = 23.4 bits (48), Expect = 8.6 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +2 Query: 437 ISLDEFLIKIRPPMSESRRNIVE 505 I LD+FL+ +RP + RR E Sbjct: 526 IELDKFLVALRPGANRIRRRSKE 548 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 797,638 Number of Sequences: 2352 Number of extensions: 15025 Number of successful extensions: 24 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 86902827 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -