BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0861 (820 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 23 3.4 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 23 4.5 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 22 5.9 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 23.0 bits (47), Expect = 3.4 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -2 Query: 267 APRDKQSKRSFSRGSVACVIARALFCI 187 A +D++ + F VA V RAL C+ Sbjct: 409 AEQDRRERMEFDWKQVALVSDRALLCV 435 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 22.6 bits (46), Expect = 4.5 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +3 Query: 381 IKVKPKNSSVNSTQTVVAQSVLMNSLLKSVLPCRN 485 +KV+ + S S Q Q+++ N KS+L N Sbjct: 970 VKVQSQQQSQQSQQQQQQQTIVTNQAGKSILQTAN 1004 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 22.2 bits (45), Expect = 5.9 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -3 Query: 284 VPRSLKHLGTSKASAVSPED 225 +P++L +GTS S V P D Sbjct: 467 IPQNLGVIGTSNLSLVFPND 486 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 207,351 Number of Sequences: 438 Number of extensions: 4159 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26096055 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -