BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0858 (551 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z19555-2|CAA79619.2| 394|Caenorhabditis elegans Hypothetical pr... 31 0.42 Z79694-7|CAB01964.1| 396|Caenorhabditis elegans Hypothetical pr... 29 1.7 Z69902-12|CAA93771.2| 525|Caenorhabditis elegans Hypothetical p... 28 5.1 AL033535-2|CAA22132.2| 525|Caenorhabditis elegans Hypothetical ... 28 5.1 Z81576-5|CAB04646.2| 1696|Caenorhabditis elegans Hypothetical pr... 27 9.0 >Z19555-2|CAA79619.2| 394|Caenorhabditis elegans Hypothetical protein F02A9.4b protein. Length = 394 Score = 31.5 bits (68), Expect = 0.42 Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 2/35 (5%) Frame = +3 Query: 354 PDNIYQA--RYKDKIDAVKGSAYNEAYMHILARGS 452 PDN+ +A RY++ +DA G +Y + H +RGS Sbjct: 342 PDNLIEAVLRYRNVVDAEVGKSYTKRLRHKFSRGS 376 >Z79694-7|CAB01964.1| 396|Caenorhabditis elegans Hypothetical protein C15A11.7 protein. Length = 396 Score = 29.5 bits (63), Expect = 1.7 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = -1 Query: 116 VIPFISIGRFRTRPSDRHTCHHYYDQYFHCRLLII 12 +IPF+ I F + +H HYY +Y+H + ++ Sbjct: 58 LIPFVFIHTFWWATAIKHDFFHYYPEYWHMPVTMV 92 >Z69902-12|CAA93771.2| 525|Caenorhabditis elegans Hypothetical protein VF13D12L.1 protein. Length = 525 Score = 27.9 bits (59), Expect = 5.1 Identities = 14/35 (40%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = +3 Query: 54 MACVAVTWARAESTYTDKWDNIN--VDEILESNRL 152 + CV V W YTD +N DEI+ES R+ Sbjct: 228 LECVIVLWTANTERYTDVRQGLNATADEIMESIRV 262 >AL033535-2|CAA22132.2| 525|Caenorhabditis elegans Hypothetical protein VF13D12L.1 protein. Length = 525 Score = 27.9 bits (59), Expect = 5.1 Identities = 14/35 (40%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = +3 Query: 54 MACVAVTWARAESTYTDKWDNIN--VDEILESNRL 152 + CV V W YTD +N DEI+ES R+ Sbjct: 228 LECVIVLWTANTERYTDVRQGLNATADEIMESIRV 262 >Z81576-5|CAB04646.2| 1696|Caenorhabditis elegans Hypothetical protein R10E8.6 protein. Length = 1696 Score = 27.1 bits (57), Expect = 9.0 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = -1 Query: 92 RFRTRPSDRHTCHHYYDQYFHCRLLII 12 + R R S+ HT YY Q CRL II Sbjct: 1414 KLRIRQSNAHTLFVYYKQPIGCRLDII 1440 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,310,336 Number of Sequences: 27780 Number of extensions: 232644 Number of successful extensions: 658 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 646 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 658 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1123720628 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -