BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0856 (816 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ006778-1|CAA07243.1| 2785|Homo sapiens DRIM protein protein. 32 2.9 >AJ006778-1|CAA07243.1| 2785|Homo sapiens DRIM protein protein. Length = 2785 Score = 31.9 bits (69), Expect = 2.9 Identities = 20/66 (30%), Positives = 30/66 (45%), Gaps = 1/66 (1%) Frame = -2 Query: 206 RDLNKSFYFNKQHYFFKLNYIIIHKYTHRFKWLFVNPNQLYLMQMRFKC-DLIEIY*VKE 30 RDL FY + +F + I+ + T +W F + + LY R D+ IY + Sbjct: 116 RDLQMDFYPHFPEFFLTITSILETQDTELLEWAFTSLSYLYKYLWRLMVKDMSSIYSMYS 175 Query: 29 TLLKTK 12 TLL K Sbjct: 176 TLLAHK 181 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 101,904,244 Number of Sequences: 237096 Number of extensions: 1836580 Number of successful extensions: 2241 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2206 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2241 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 10147868276 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -