BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0855 (788 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT015985-1|AAV36870.1| 738|Drosophila melanogaster RE58108p pro... 31 2.4 AE013599-3292|AAF46773.1| 287|Drosophila melanogaster CG4054-PA... 31 2.4 >BT015985-1|AAV36870.1| 738|Drosophila melanogaster RE58108p protein. Length = 738 Score = 30.7 bits (66), Expect = 2.4 Identities = 15/56 (26%), Positives = 32/56 (57%), Gaps = 4/56 (7%) Frame = -2 Query: 475 NIPFFITSRL----SNLLPTITPQR*EYQSQIFSLRLTITKFHIVNKQTFRNVTNL 320 ++PF++ + N++ T+ + EYQS++ +L L+ ++K F+ +TNL Sbjct: 91 SLPFYMKLEILDLSQNIIETLGSKNFEYQSELRTLNLSRNLVSSLHKHAFKGLTNL 146 >AE013599-3292|AAF46773.1| 287|Drosophila melanogaster CG4054-PA protein. Length = 287 Score = 30.7 bits (66), Expect = 2.4 Identities = 15/56 (26%), Positives = 32/56 (57%), Gaps = 4/56 (7%) Frame = -2 Query: 475 NIPFFITSRL----SNLLPTITPQR*EYQSQIFSLRLTITKFHIVNKQTFRNVTNL 320 ++PF++ + N++ T+ + EYQS++ +L L+ ++K F+ +TNL Sbjct: 91 SLPFYMKLEILDLSQNIIETLGSKNFEYQSELRTLNLSRNLVSSLHKHAFKGLTNL 146 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 34,772,186 Number of Sequences: 53049 Number of extensions: 740486 Number of successful extensions: 1764 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1695 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1764 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 3654740856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -