BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0855 (788 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U40935-1|AAA81687.1| 1131|Caenorhabditis elegans Hypothetical pr... 29 5.0 AC024772-3|AAF60538.1| 2344|Caenorhabditis elegans Hypothetical ... 28 6.6 >U40935-1|AAA81687.1| 1131|Caenorhabditis elegans Hypothetical protein F31E3.4 protein. Length = 1131 Score = 28.7 bits (61), Expect = 5.0 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = -2 Query: 376 TITKFHIVNKQTFRNVTNLRYVTQRMLSCLYTSPGVYNENI 254 T+ H+ Q VT +R TQRMLS + + E I Sbjct: 1016 TVLNVHVAESQIIDTVTLMRLGTQRMLSLQFLVKEILGETI 1056 >AC024772-3|AAF60538.1| 2344|Caenorhabditis elegans Hypothetical protein Y40C5A.3 protein. Length = 2344 Score = 28.3 bits (60), Expect = 6.6 Identities = 21/73 (28%), Positives = 32/73 (43%) Frame = -3 Query: 732 SPT*MRHPP*DTSSKVSSIVTTAAPPFKPKTHYCFTAEIGRVVVPTRADSQEVLPPVRLA 553 S T H +T+S + T P KPKT T+ + P S+ + PPV A Sbjct: 1378 STTVTEHIDAETNSATIPTIGTPPSPLKPKTKLGLTSH-PSAIPPWAISSKTLAPPV--A 1434 Query: 552 P*SLSKPRITGPN 514 P +++ P P+ Sbjct: 1435 PPTVTVPSNIAPS 1447 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,643,617 Number of Sequences: 27780 Number of extensions: 373817 Number of successful extensions: 795 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 782 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 795 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1914239236 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -