BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0852 (752 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY341178-1|AAR13742.1| 230|Anopheles gambiae ferredoxin reducta... 27 0.82 AY341177-1|AAR13741.1| 230|Anopheles gambiae ferredoxin reducta... 27 0.82 AY341176-1|AAR13740.1| 230|Anopheles gambiae ferredoxin reducta... 27 0.82 AY341175-1|AAR13739.1| 230|Anopheles gambiae ferredoxin reducta... 27 0.82 AF046924-1|AAC08530.1| 122|Anopheles gambiae mucin protein. 24 5.8 >AY341178-1|AAR13742.1| 230|Anopheles gambiae ferredoxin reductase protein. Length = 230 Score = 26.6 bits (56), Expect = 0.82 Identities = 13/39 (33%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +3 Query: 57 IVDGDICLFDMGGN-YAGYAADITCSFPANGKFTEDQKL 170 ++D DIC+F +G Y + S NG DQ L Sbjct: 52 LLDADICIFGIGSTLYTEFLQGSGISLNRNGSINTDQYL 90 >AY341177-1|AAR13741.1| 230|Anopheles gambiae ferredoxin reductase protein. Length = 230 Score = 26.6 bits (56), Expect = 0.82 Identities = 13/39 (33%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +3 Query: 57 IVDGDICLFDMGGN-YAGYAADITCSFPANGKFTEDQKL 170 ++D DIC+F +G Y + S NG DQ L Sbjct: 52 LLDADICIFGIGSTLYTEFLQGSGISLNRNGSINTDQYL 90 >AY341176-1|AAR13740.1| 230|Anopheles gambiae ferredoxin reductase protein. Length = 230 Score = 26.6 bits (56), Expect = 0.82 Identities = 13/39 (33%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +3 Query: 57 IVDGDICLFDMGGN-YAGYAADITCSFPANGKFTEDQKL 170 ++D DIC+F +G Y + S NG DQ L Sbjct: 52 LLDADICIFGIGSTLYTEFLQGSGISLNRNGSINTDQYL 90 >AY341175-1|AAR13739.1| 230|Anopheles gambiae ferredoxin reductase protein. Length = 230 Score = 26.6 bits (56), Expect = 0.82 Identities = 13/39 (33%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +3 Query: 57 IVDGDICLFDMGGN-YAGYAADITCSFPANGKFTEDQKL 170 ++D DIC+F +G Y + S NG DQ L Sbjct: 52 LLDADICIFGIGSTLYTEFLQGSGISLNRNGSINTDQYL 90 >AF046924-1|AAC08530.1| 122|Anopheles gambiae mucin protein. Length = 122 Score = 23.8 bits (49), Expect = 5.8 Identities = 12/37 (32%), Positives = 16/37 (43%) Frame = -2 Query: 499 PGSTVSTIPAKSCLAVRSLARGPVILGGQLGRYPPTS 389 PG T +T A ++A GPV G P+S Sbjct: 61 PGQTTTTTVAPGQTTTTTVASGPVTTTGSTDTTTPSS 97 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 747,822 Number of Sequences: 2352 Number of extensions: 15921 Number of successful extensions: 54 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 53 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 54 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 77755161 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -