BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0851 (782 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 25 0.68 AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory recept... 23 2.1 AF264721-1|AAF75273.1| 126|Tribolium castaneum putative cytochr... 23 2.1 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 21 8.4 AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 21 8.4 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 25.0 bits (52), Expect = 0.68 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = +3 Query: 270 RCSQICSRIDFLMGGLWSA 326 +C + C+R+D+ M G +SA Sbjct: 796 QCCKNCARVDYSMNGTYSA 814 >AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory receptor candidate 58 protein. Length = 376 Score = 23.4 bits (48), Expect = 2.1 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = +3 Query: 261 RCVRCSQICSRIDFLMGGLWSA*KFLWCYR*RF 359 RC + S IC + ++G W ++C RF Sbjct: 40 RCDKISAICFLLSTILGTCWIIYVRIYCKEIRF 72 >AF264721-1|AAF75273.1| 126|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q2 protein. Length = 126 Score = 23.4 bits (48), Expect = 2.1 Identities = 9/22 (40%), Positives = 15/22 (68%), Gaps = 2/22 (9%) Frame = -2 Query: 280 CEQRTQRAV--EVKDLLGDLHA 221 C + Q + E++D+LGD+HA Sbjct: 14 CHKDVQETILQEMRDVLGDIHA 35 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = -2 Query: 727 LGTYLVDNHHVNEFFLHKRLQNHQ 656 L T ++NHH+ + Q+HQ Sbjct: 157 LTTQSMNNHHMGHHMQEQHPQHHQ 180 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = -2 Query: 727 LGTYLVDNHHVNEFFLHKRLQNHQ 656 L T ++NHH+ + Q+HQ Sbjct: 159 LTTQSMNNHHMGHHMQEQHPQHHQ 182 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 197,907 Number of Sequences: 336 Number of extensions: 4632 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21168876 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -