BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0851 (782 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12514| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 29 4.2 >SB_12514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = +2 Query: 230 VSKQVLDLNCTLRTLFTNLFKDRLPDGRTLVSMKVPLVLPLEVRAY 367 V +VLDL+ +RT F N F R + L +P + + V+ + Sbjct: 63 VRNKVLDLSAEIRTYFNNTFSKRQTACQMLYRYLIPFSVEINVKLF 108 >SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) Length = 397 Score = 29.1 bits (62), Expect = 4.2 Identities = 14/45 (31%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +2 Query: 35 HKS*TMSQAVKAITLE-DEYKKKTGITPEDVRKMRQWLQTQPHLP 166 HK+ + ++ K T E + ++K PED K+ +W +PH P Sbjct: 203 HKTSSPTRMFKRATSERNPQQRKLPPEPEDYNKLEEWTGDKPHPP 247 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,869,230 Number of Sequences: 59808 Number of extensions: 576150 Number of successful extensions: 1221 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1118 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1219 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2143884611 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -