BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0850 (768 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropi... 22 7.2 DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein ... 21 9.5 AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific pro... 21 9.5 >AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropin releasing hormone-binding protein protein. Length = 332 Score = 21.8 bits (44), Expect = 7.2 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +1 Query: 523 KDNSCDSYVAFAIILSP*MLISTISFFRYI*ISINELTC 639 K+N ++YV F ++ + S +F Y + NE C Sbjct: 54 KNNLLNAYVRFKLVTDCIFVTSEPGYFLYTSKNDNEEVC 92 >DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein 3 protein. Length = 130 Score = 21.4 bits (43), Expect = 9.5 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -3 Query: 124 PFKKYAIKFESDLVEL 77 P KKY +KFE + +L Sbjct: 111 PDKKYRVKFEEEAKKL 126 >AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific protein 3c precursor protein. Length = 130 Score = 21.4 bits (43), Expect = 9.5 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -3 Query: 124 PFKKYAIKFESDLVEL 77 P KKY +KFE + +L Sbjct: 111 PDKKYRVKFEEEAKKL 126 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 189,340 Number of Sequences: 438 Number of extensions: 3584 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24032646 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -