BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0849 (811 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 ... 26 0.41 EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 24 1.2 >EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 protein. Length = 493 Score = 25.8 bits (54), Expect = 0.41 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = -2 Query: 624 LAYYYHLM*FILWQTSKATIVSPYLYFHICFKLII 520 L YY + + WQ+ P+L+F + L+I Sbjct: 12 LLYYIYSKHYSYWQSKNVPTDKPFLFFGSFYNLVI 46 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -1 Query: 283 YTETLELISQGGWRIYVVDD 224 Y E +EL +GGW++ V DD Sbjct: 299 YNEIVELQKEGGWKV-VWDD 317 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 204,285 Number of Sequences: 336 Number of extensions: 4469 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22102797 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -