BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0849 (811 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37378| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 >SB_37378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 781 Score = 29.1 bits (62), Expect = 4.5 Identities = 23/85 (27%), Positives = 42/85 (49%), Gaps = 4/85 (4%) Frame = -3 Query: 272 LRTYISRWVAHLRCR*LWVPVTT*HQVGCELVHS---YMQ*KKKYIFN-FT*NHINNLEM 105 +R+++S W R L+ PV Q G +LV S ++ K+ I NH +E+ Sbjct: 468 VRSFLSEWSCLDRVGSLFFPVIMSKQSG-KLVFSRGHVLKVSKQCITGRLVKNHYGTVEL 526 Query: 104 PREQIYKETFVVIEVALVNLYQAHF 30 P +Q+ K + +E++ L + H+ Sbjct: 527 PPKQLVKNHYGTVELSPKQLVKNHY 551 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,548,219 Number of Sequences: 59808 Number of extensions: 501928 Number of successful extensions: 783 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 737 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 783 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2251677692 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -