BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0848 (604 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 34 0.001 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 22 4.0 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 22 4.0 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 22 4.0 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 22 4.0 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 22 4.0 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 22 4.0 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 22 4.0 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 4.0 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 22 5.3 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 22 5.3 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 21 7.0 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 21 9.3 DQ435327-1|ABD92642.1| 145|Apis mellifera OBP10 protein. 21 9.3 AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-act... 21 9.3 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 21 9.3 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 33.9 bits (74), Expect = 0.001 Identities = 21/47 (44%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = -1 Query: 283 GFHSPHHSRLLAPYPRRPGLLPTPAWTPGPRR-RHHLERPQIARDTR 146 G H P H +L+ +P R G LPTP TP P + L R QI R+ R Sbjct: 137 GNHLPFHEKLVESFP-RGGSLPTPV-TPTPTTVQQLLRRAQIRRNER 181 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 22.2 bits (45), Expect = 4.0 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 246 HIHGAQVCFRHQRGH 202 H H AQ+ + HQ+ H Sbjct: 796 HQHAAQMIYGHQQSH 810 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 22.2 bits (45), Expect = 4.0 Identities = 11/37 (29%), Positives = 22/37 (59%) Frame = +1 Query: 367 RIGKNVLNQKSELEKALSKHKEKQILNQMREQQHKDA 477 +IGK V + SEL ++ +H +++L + + + DA Sbjct: 254 KIGKMVNQKFSELIQSKPQHARRKVLAGIVQTKGSDA 290 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 22.2 bits (45), Expect = 4.0 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 519 RTSRADYRRSRAGHKPDFARDTS 587 RTSR Y RSR K + + S Sbjct: 33 RTSRKRYSRSREREKKSYKNENS 55 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 22.2 bits (45), Expect = 4.0 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 519 RTSRADYRRSRAGHKPDFARDTS 587 RTSR Y RSR K + + S Sbjct: 33 RTSRKRYSRSREREKKSYKNENS 55 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 22.2 bits (45), Expect = 4.0 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 519 RTSRADYRRSRAGHKPDFARDTS 587 RTSR Y RSR K + + S Sbjct: 33 RTSRKRYSRSREREKKSYKNENS 55 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 22.2 bits (45), Expect = 4.0 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 519 RTSRADYRRSRAGHKPDFARDTS 587 RTSR Y RSR K + + S Sbjct: 33 RTSRKRYSRSREREKKSYKNENS 55 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 22.2 bits (45), Expect = 4.0 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 519 RTSRADYRRSRAGHKPDFARDTS 587 RTSR Y RSR K + + S Sbjct: 266 RTSRKRYSRSREREKKSYKNENS 288 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.2 bits (45), Expect = 4.0 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -1 Query: 247 PYPRRPGLLPTPAWTPGPRRR 185 P P RP +PT +P P R Sbjct: 1364 PVPERPERVPTVDLSPSPSDR 1384 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 21.8 bits (44), Expect = 5.3 Identities = 13/49 (26%), Positives = 19/49 (38%) Frame = -3 Query: 326 GLSKHGFGSRRGAMRLSLPAPLSPSCTISTAPRFASDTSVDTRSTPPPP 180 G S G G G + + S + + P + TS +TP PP Sbjct: 7 GGSSAGVGVVGGTIASVVAGAASLTLVKAETPEHLAGTSTTAAATPTPP 55 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.8 bits (44), Expect = 5.3 Identities = 10/49 (20%), Positives = 26/49 (53%) Frame = +1 Query: 319 ESPQRMDLHRELLFNQRIGKNVLNQKSELEKALSKHKEKQILNQMREQQ 465 E Q+M ++ Q+ ++V+N + ++ + +++Q Q ++QQ Sbjct: 413 EQQQQMQAQQQHQQQQQQTQHVINAQQPQQQQQQQQQQQQQQQQQQQQQ 461 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.4 bits (43), Expect = 7.0 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = -3 Query: 242 STAPRFASDTSVDTRSTPP 186 S PR AS S T S+PP Sbjct: 512 SPNPRIASAPSSSTSSSPP 530 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 21.0 bits (42), Expect = 9.3 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = -3 Query: 221 SDTSVDTRSTPPPPLRASTDS 159 SDT PPPP + DS Sbjct: 335 SDTPPKPAPPPPPPSSSGPDS 355 >DQ435327-1|ABD92642.1| 145|Apis mellifera OBP10 protein. Length = 145 Score = 21.0 bits (42), Expect = 9.3 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 260 SPSCTISTAPRFASDTSVDTRST 192 SPS T P F SD + T ++ Sbjct: 17 SPSVHCGTRPSFVSDEMIATAAS 39 >AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-activated ion channelvariant T protein. Length = 288 Score = 21.0 bits (42), Expect = 9.3 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -3 Query: 206 DTRSTPPPPLRASTD 162 + R+TPP P R S D Sbjct: 248 ERRATPPQPDRTSKD 262 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.0 bits (42), Expect = 9.3 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -3 Query: 206 DTRSTPPPPL 177 D TPPPPL Sbjct: 333 DVTGTPPPPL 342 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,166 Number of Sequences: 438 Number of extensions: 3451 Number of successful extensions: 39 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 39 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17726685 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -