BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0847 (825 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC7D4.03c |||conserved fungal family|Schizosaccharomyces pombe... 27 3.2 SPAC19D5.04 |ptr1||HECT domain|Schizosaccharomyces pombe|chr 1||... 27 4.3 SPAC31G5.04 |||homoisocitrate dehydrogenase|Schizosaccharomyces ... 27 4.3 SPCC1322.12c |bub1||serine/threonine protein kinase Bub1|Schizos... 25 9.9 >SPAC7D4.03c |||conserved fungal family|Schizosaccharomyces pombe|chr 1|||Manual Length = 886 Score = 27.1 bits (57), Expect = 3.2 Identities = 9/33 (27%), Positives = 18/33 (54%) Frame = +3 Query: 150 RQRYFKYLAFRSRLIVEIGRRENSFNFKQCFFL 248 RQ + LA ++++ + + +FN + CF L Sbjct: 486 RQEQMRLLAVLEQVLINVAKNTPAFNLQSCFLL 518 >SPAC19D5.04 |ptr1||HECT domain|Schizosaccharomyces pombe|chr 1|||Manual Length = 3227 Score = 26.6 bits (56), Expect = 4.3 Identities = 19/62 (30%), Positives = 34/62 (54%) Frame = -1 Query: 600 PSKEY*ESFVIKKITYNLPDLLDLFKKNLFSHRPVYTAFSFKS*K*Y*NHIFLLRNICIV 421 PSKE S ++ ++ L +L+DL + FS R + F+ ++ Y ++FLL+ C+ Sbjct: 1545 PSKEQMSSVIV---SFLLDELMDLTETRQFSDRSPNSEFTPENDSLYMYNVFLLQ--CLT 1599 Query: 420 NL 415 L Sbjct: 1600 EL 1601 >SPAC31G5.04 |||homoisocitrate dehydrogenase|Schizosaccharomyces pombe|chr 1|||Manual Length = 362 Score = 26.6 bits (56), Expect = 4.3 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = -2 Query: 251 LQKKTLFKIKTVFTPAYFHYKSAPERKVFEISLPIVSVPRK 129 L ++T+ ++KT A F +P KV S PIV++ +K Sbjct: 59 LPERTVERLKTECNAALFGAVQSPTHKVAGYSSPIVALRKK 99 >SPCC1322.12c |bub1||serine/threonine protein kinase Bub1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1044 Score = 25.4 bits (53), Expect = 9.9 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 3/34 (8%) Frame = -2 Query: 206 AYFHYKSAPERKVFEISLPIVSVPR---KPCLPT 114 AY ++PE KVF+ +P+ P+ KP PT Sbjct: 350 AYVAKSTSPELKVFDTVMPVALSPKPAQKPPSPT 383 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,043,872 Number of Sequences: 5004 Number of extensions: 59857 Number of successful extensions: 151 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 146 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 151 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 404442380 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -