BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0847 (825 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U41990-3|AAY44010.1| 291|Caenorhabditis elegans Hypothetical pr... 29 4.0 AF003385-1|AAB54243.1| 884|Caenorhabditis elegans Hypothetical ... 28 7.1 >U41990-3|AAY44010.1| 291|Caenorhabditis elegans Hypothetical protein F52B10.2 protein. Length = 291 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/30 (50%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = -2 Query: 212 TPAYFHYKSAPER-KVFEISLPIVSVPRKP 126 +PAYFH K APER K + I+ V R P Sbjct: 92 SPAYFHSKMAPERIKSLNPNTKIIIVVRDP 121 >AF003385-1|AAB54243.1| 884|Caenorhabditis elegans Hypothetical protein R08F11.1 protein. Length = 884 Score = 28.3 bits (60), Expect = 7.1 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = -2 Query: 806 LVSVHTFKIFPVIYMSLLPCA 744 +V+VH+ K F +IY S+L CA Sbjct: 151 IVTVHSKKTFELIYQSILSCA 171 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,403,383 Number of Sequences: 27780 Number of extensions: 322061 Number of successful extensions: 677 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 651 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 677 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 2040452812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -