BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0847 (825 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 22 7.9 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 22 7.9 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 22 7.9 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.8 bits (44), Expect = 7.9 Identities = 12/47 (25%), Positives = 24/47 (51%) Frame = -2 Query: 788 FKIFPVIYMSLLPCANQAGLSSLIKY*ATNFILKTIKKVFLKDRPKL 648 + IF +I +S+ C L+ + T+ + +K+VF+ P+L Sbjct: 310 YLIFAMILVSISICVTVVVLNVHFRSPQTHKMAPWVKRVFIHILPRL 356 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.8 bits (44), Expect = 7.9 Identities = 12/47 (25%), Positives = 24/47 (51%) Frame = -2 Query: 788 FKIFPVIYMSLLPCANQAGLSSLIKY*ATNFILKTIKKVFLKDRPKL 648 + IF +I +S+ C L+ + T+ + +K+VF+ P+L Sbjct: 310 YLIFAMILVSISICVTVVVLNVHFRSPQTHKMAPWVKRVFIHILPRL 356 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.8 bits (44), Expect = 7.9 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = +3 Query: 66 NNCLQCLIFRCIFLSRSRQA 125 N C C + +CI + SR A Sbjct: 118 NRCQYCRLKKCIAVGMSRDA 137 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 200,521 Number of Sequences: 438 Number of extensions: 4192 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26338809 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -