BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0845 (484 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34124| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_36751| Best HMM Match : Exo_endo_phos (HMM E-Value=2e-12) 28 4.6 >SB_34124| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 468 Score = 28.7 bits (61), Expect = 2.7 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -1 Query: 274 GHGGTVRMAASRNPA-PRIYTDCENC*TI*PHTKP 173 G+GG + A + N + PR + CEN I HTKP Sbjct: 409 GYGGPLTCANNENTSIPRCSSRCENVVHIIDHTKP 443 >SB_36751| Best HMM Match : Exo_endo_phos (HMM E-Value=2e-12) Length = 906 Score = 27.9 bits (59), Expect = 4.6 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = +2 Query: 167 YSWFCMGLYSSAILAVSVYSWCWISACCHSYCSSMANVP 283 + WFC G S +L+ V + ++++ CH + S + P Sbjct: 731 HQWFCHGWLSPVVLSRVVVTSGFVTSGCHEWLSLVVLSP 769 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,476,712 Number of Sequences: 59808 Number of extensions: 202590 Number of successful extensions: 411 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 391 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 411 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1013948003 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -