BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0845 (484 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 23 1.7 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 22 4.0 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 21 9.1 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 21 9.1 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 23.0 bits (47), Expect = 1.7 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -3 Query: 191 ITPYKTNYTEQCN 153 +TPY NYT+ C+ Sbjct: 443 VTPYNKNYTKFCS 455 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 21.8 bits (44), Expect = 4.0 Identities = 8/13 (61%), Positives = 12/13 (92%) Frame = +3 Query: 87 TSIPTHIDYVGQA 125 TS+PT+I Y+G+A Sbjct: 652 TSMPTYICYLGKA 664 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 20.6 bits (41), Expect = 9.1 Identities = 8/41 (19%), Positives = 17/41 (41%) Frame = +3 Query: 99 THIDYVGQAKAEKLYRAIITLFSIVGFVWGYIVQQFSQSVY 221 T DY + +++I + + W Y+ +S+ Y Sbjct: 110 TRFDYFARTVPPDTFQSIALVDVVKSANWSYVSTVYSEGSY 150 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 20.6 bits (41), Expect = 9.1 Identities = 8/41 (19%), Positives = 17/41 (41%) Frame = +3 Query: 99 THIDYVGQAKAEKLYRAIITLFSIVGFVWGYIVQQFSQSVY 221 T DY + +++I + + W Y+ +S+ Y Sbjct: 200 TRFDYFARTVPPDTFQSIALVDVVKSANWSYVSTVYSEGSY 240 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 111,924 Number of Sequences: 438 Number of extensions: 2263 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13174803 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -