BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0844 (378 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 22 2.1 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 3.6 L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein pro... 20 8.4 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 20 8.4 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 20 8.4 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 20 8.4 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 22.2 bits (45), Expect = 2.1 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +1 Query: 148 LFALPASSYMIQERFKNIDSSKSM 219 LF L S QE+ KNI S K++ Sbjct: 10 LFLLAISDSQAQEKLKNIYSWKAL 33 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.4 bits (43), Expect = 3.6 Identities = 7/26 (26%), Positives = 15/26 (57%) Frame = +2 Query: 11 RLTGTSIIFNAKSILMCSCMNNPKYY 88 R+T S+ + + + +C+ +PK Y Sbjct: 878 RITSMSVTISLSASVTIACLFSPKLY 903 >L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein protein. Length = 69 Score = 20.2 bits (40), Expect = 8.4 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -2 Query: 74 CSYSCTLKSI 45 CSYSC KS+ Sbjct: 22 CSYSCVNKSM 31 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 20.2 bits (40), Expect = 8.4 Identities = 9/39 (23%), Positives = 17/39 (43%) Frame = -1 Query: 147 RHYYTFTSQPSVTITPTHRE*YFGLFIQLHIKIDFALKI 31 R+ F + + P H + Y + LH +I A+ + Sbjct: 301 RNGLAFPQRETGATVPLHMQKYVQMIHDLHTRISTAIDL 339 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 20.2 bits (40), Expect = 8.4 Identities = 9/39 (23%), Positives = 17/39 (43%) Frame = -1 Query: 147 RHYYTFTSQPSVTITPTHRE*YFGLFIQLHIKIDFALKI 31 R+ F + + P H + Y + LH +I A+ + Sbjct: 301 RNGLAFPQRETGATVPLHMQKYVQMIHDLHTRISTAIDL 339 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 20.2 bits (40), Expect = 8.4 Identities = 7/20 (35%), Positives = 9/20 (45%) Frame = -2 Query: 359 GHQDHHRGPAPRHSEKHSAS 300 GH H P H H+A+ Sbjct: 420 GHGHSHIHATPHHHHSHAAT 439 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 112,398 Number of Sequences: 438 Number of extensions: 2868 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 9176370 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -