BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0842 (829 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcript... 27 0.53 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 26 1.6 AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcript... 24 5.0 >AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcriptase protein. Length = 988 Score = 27.5 bits (58), Expect = 0.53 Identities = 15/35 (42%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = +1 Query: 715 ERQDPRRVVPRLG-PTAVRFASVRQTVSHNRTCVV 816 +++ R+ V R P A+R AS QTVS++ CVV Sbjct: 796 DKETHRKSVQRAHRPGALRVASAFQTVSYDAACVV 830 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 25.8 bits (54), Expect = 1.6 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = +2 Query: 308 GQHECQRISRPCPGSPPRLSPTVAADWRRRCYSS*PRECC 427 G H CQR S+ SP + + RC+ PRECC Sbjct: 172 GAHNCQRFSKL------NCSPQCS---QGRCFGPKPRECC 202 >AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcriptase protein. Length = 1209 Score = 24.2 bits (50), Expect = 5.0 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = -3 Query: 575 KELRGAILFTILLDSRYLFAGRSQKLHFLSLGRLGF 468 +E+ I T +D LFA QK+H L GF Sbjct: 702 EEISTRITHTFFMDDLKLFAETVQKMHHLLKNVQGF 737 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 820,287 Number of Sequences: 2352 Number of extensions: 16049 Number of successful extensions: 31 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 88150236 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -