BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0841 (818 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58335| Best HMM Match : SMC_N (HMM E-Value=0.023) 29 3.4 SB_59318| Best HMM Match : WSC (HMM E-Value=0.00068) 28 7.9 >SB_58335| Best HMM Match : SMC_N (HMM E-Value=0.023) Length = 354 Score = 29.5 bits (63), Expect = 3.4 Identities = 19/57 (33%), Positives = 28/57 (49%) Frame = -3 Query: 816 QGGWRICVVNIYGLQ*PLNTRWAVSSSTHISNK*KAIKKRPMSSSGLPQADDDFIFL 646 +GGW V+ G Q PL R A H + + +P++ + LP DDDF+ L Sbjct: 47 RGGWISYVITTAGPQ-PLEARSAAIDYEHYLTR----QLQPVADAILPFVDDDFVTL 98 >SB_59318| Best HMM Match : WSC (HMM E-Value=0.00068) Length = 553 Score = 28.3 bits (60), Expect = 7.9 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -3 Query: 507 RKFYKARLNATSQRMTSFVAKIIEELNTLLHIQGSTTHDVIC 382 ++FY L TS +TS A L + L I S+T DV C Sbjct: 488 KEFYATTLELTSDVLTSLAAPETGTLLSQLRISLSSTADVTC 529 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,152,257 Number of Sequences: 59808 Number of extensions: 469085 Number of successful extensions: 1177 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1044 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1176 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2287608719 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -