BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0841 (818 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY341167-1|AAR13731.1| 192|Anopheles gambiae cytochrome P450 CY... 27 0.69 AY341166-1|AAR13730.1| 192|Anopheles gambiae cytochrome P450 CY... 27 0.69 AY341165-1|AAR13729.1| 192|Anopheles gambiae cytochrome P450 CY... 27 0.69 AY341164-1|AAR13728.1| 192|Anopheles gambiae cytochrome P450 CY... 27 0.69 AY341163-1|AAR13727.1| 192|Anopheles gambiae cytochrome P450 CY... 27 0.69 AY341162-1|AAR13726.1| 192|Anopheles gambiae cytochrome P450 CY... 27 0.69 AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CY... 27 0.69 >AY341167-1|AAR13731.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 27.1 bits (57), Expect = 0.69 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = -3 Query: 510 PRKFYKARLNATSQRMTSFVAKIIEELNTLLHIQGSTTHDVI 385 PR RL S +MTSF ++ + T +G HD+I Sbjct: 120 PRVMRALRLRLFSAKMTSFFRHVVMDTITQREQRGIVRHDMI 161 >AY341166-1|AAR13730.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 27.1 bits (57), Expect = 0.69 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = -3 Query: 510 PRKFYKARLNATSQRMTSFVAKIIEELNTLLHIQGSTTHDVI 385 PR RL S +MTSF ++ + T +G HD+I Sbjct: 120 PRVMRALRLRLFSAKMTSFFRHVVMDTITQREQRGIVRHDMI 161 >AY341165-1|AAR13729.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 27.1 bits (57), Expect = 0.69 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = -3 Query: 510 PRKFYKARLNATSQRMTSFVAKIIEELNTLLHIQGSTTHDVI 385 PR RL S +MTSF ++ + T +G HD+I Sbjct: 120 PRVMRALRLRLFSAKMTSFFRHVVMDTITQREQRGIVRHDMI 161 >AY341164-1|AAR13728.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 27.1 bits (57), Expect = 0.69 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = -3 Query: 510 PRKFYKARLNATSQRMTSFVAKIIEELNTLLHIQGSTTHDVI 385 PR RL S +MTSF ++ + T +G HD+I Sbjct: 120 PRVMRALRLRLFSAKMTSFFRHVVMDTITQREQRGIVRHDMI 161 >AY341163-1|AAR13727.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 27.1 bits (57), Expect = 0.69 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = -3 Query: 510 PRKFYKARLNATSQRMTSFVAKIIEELNTLLHIQGSTTHDVI 385 PR RL S +MTSF ++ + T +G HD+I Sbjct: 120 PRVMRALRLRLFSAKMTSFFRHVVMDTITQREQRGIVRHDMI 161 >AY341162-1|AAR13726.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 27.1 bits (57), Expect = 0.69 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = -3 Query: 510 PRKFYKARLNATSQRMTSFVAKIIEELNTLLHIQGSTTHDVI 385 PR RL S +MTSF ++ + T +G HD+I Sbjct: 120 PRVMRALRLRLFSAKMTSFFRHVVMDTITQREQRGIVRHDMI 161 >AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 531 Score = 27.1 bits (57), Expect = 0.69 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = -3 Query: 510 PRKFYKARLNATSQRMTSFVAKIIEELNTLLHIQGSTTHDVI 385 PR RL S +MTSF ++ + T +G HD+I Sbjct: 240 PRVMRALRLRLFSAKMTSFFRHVVMDTITQREQRGIVRHDMI 281 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 835,614 Number of Sequences: 2352 Number of extensions: 15014 Number of successful extensions: 46 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 46 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 86902827 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -