BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0841 (818 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g55830.1 68416.m06203 glycosyltransferase family protein 47 s... 30 1.6 At4g12240.1 68417.m01941 zinc finger (C2H2 type) family protein ... 29 4.9 At3g26510.4 68416.m03309 octicosapeptide/Phox/Bem1p (PB1) domain... 28 6.5 At3g26510.3 68416.m03306 octicosapeptide/Phox/Bem1p (PB1) domain... 28 6.5 At3g26510.2 68416.m03307 octicosapeptide/Phox/Bem1p (PB1) domain... 28 6.5 At3g26510.1 68416.m03308 octicosapeptide/Phox/Bem1p (PB1) domain... 28 6.5 At5g52950.1 68418.m06570 expressed protein ; expression supporte... 28 8.6 At1g30120.1 68414.m03681 pyruvate dehydrogenase E1 component bet... 28 8.6 At1g21370.2 68414.m02674 expressed protein 28 8.6 At1g21370.1 68414.m02673 expressed protein 28 8.6 >At3g55830.1 68416.m06203 glycosyltransferase family protein 47 similar to exostose-related protein 2, Homo sapiens, PIR:JC5935 [SP|Q93063], EXTL2, Mus musculus [GI:10443633] Length = 334 Score = 30.3 bits (65), Expect = 1.6 Identities = 19/62 (30%), Positives = 29/62 (46%) Frame = -1 Query: 590 LPTNTVHNFEPFLIFPAYTGDLLFSNHHANFTKLA*TQLHSE*RHSWPK*SKS*THYYTY 411 L T+ V + + +IFP +T D F+ + T + R WP+ S +YYTY Sbjct: 157 LKTDAVFSIDDDIIFPCHTVDFAFNV----WESAPDTMVGFVPRVHWPEKSNDKANYYTY 212 Query: 410 KG 405 G Sbjct: 213 SG 214 >At4g12240.1 68417.m01941 zinc finger (C2H2 type) family protein contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 364 Score = 28.7 bits (61), Expect = 4.9 Identities = 15/58 (25%), Positives = 29/58 (50%) Frame = +2 Query: 125 NVLQRKRSADLREKIKHQLLIEYWYWFINKQPDTNVETI*KHLYRVLLKKERSLIIFV 298 NVL K L +++K +W ++ +PD + + +HL V+ K+E ++ V Sbjct: 179 NVLTPKEGYGLADELKRA---GFWVKMVSDKPDAADKALKEHLVEVMDKREVECVVLV 233 >At3g26510.4 68416.m03309 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein contains Pfam profile PF00564: PB1 domain Length = 196 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = +3 Query: 240 SKNTYTGCCLKRNARSLFLYNNNNN 314 +KN GC + RN+R+++L +N N+ Sbjct: 170 TKNPCYGCYVHRNSRNIYLVHNGNH 194 >At3g26510.3 68416.m03306 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein contains Pfam profile PF00564: PB1 domain Length = 218 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = +3 Query: 240 SKNTYTGCCLKRNARSLFLYNNNNN 314 +KN GC + RN+R+++L +N N+ Sbjct: 192 TKNPCYGCYVHRNSRNIYLVHNGNH 216 >At3g26510.2 68416.m03307 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein contains Pfam profile PF00564: PB1 domain Length = 196 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = +3 Query: 240 SKNTYTGCCLKRNARSLFLYNNNNN 314 +KN GC + RN+R+++L +N N+ Sbjct: 170 TKNPCYGCYVHRNSRNIYLVHNGNH 194 >At3g26510.1 68416.m03308 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein contains Pfam profile PF00564: PB1 domain Length = 196 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = +3 Query: 240 SKNTYTGCCLKRNARSLFLYNNNNN 314 +KN GC + RN+R+++L +N N+ Sbjct: 170 TKNPCYGCYVHRNSRNIYLVHNGNH 194 >At5g52950.1 68418.m06570 expressed protein ; expression supported by MPSS Length = 945 Score = 27.9 bits (59), Expect = 8.6 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = -1 Query: 110 QTIDHRQVVQRINCSSYKR 54 QT+DH ++++CS YKR Sbjct: 465 QTVDHEDSRKKVSCSEYKR 483 >At1g30120.1 68414.m03681 pyruvate dehydrogenase E1 component beta subunit, chloroplast identical to pyruvate dehydrogenase E1 beta subunit [Arabidopsis thaliana] GI:2454184; identical to cDNA pyruvate dehydrogenase E1 beta subunit mRNA, nuclear gene encoding plastid protein GI:2454183 Length = 406 Score = 27.9 bits (59), Expect = 8.6 Identities = 13/36 (36%), Positives = 24/36 (66%) Frame = +2 Query: 500 NLRGDLKKEDLLCTLEK*EMVRSCEQYLSVRSFLRL 607 NL+ + ED +C LE+ EMVR E ++++ ++ R+ Sbjct: 260 NLKEKIPDEDYVCNLEEAEMVRPGE-HITILTYSRM 294 >At1g21370.2 68414.m02674 expressed protein Length = 342 Score = 27.9 bits (59), Expect = 8.6 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -2 Query: 289 NERAFLFKQHPV*VFLDCFHIGVRLLI 209 N +FK HPV VF+ C G+ +LI Sbjct: 48 NRLHHMFKLHPVLVFVVCVSFGITVLI 74 >At1g21370.1 68414.m02673 expressed protein Length = 342 Score = 27.9 bits (59), Expect = 8.6 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -2 Query: 289 NERAFLFKQHPV*VFLDCFHIGVRLLI 209 N +FK HPV VF+ C G+ +LI Sbjct: 48 NRLHHMFKLHPVLVFVVCVSFGITVLI 74 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,852,270 Number of Sequences: 28952 Number of extensions: 324921 Number of successful extensions: 752 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 727 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 752 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1872844800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -