BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0836 (745 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 23 3.0 AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropi... 23 4.0 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 22 7.0 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 23.0 bits (47), Expect = 3.0 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = -3 Query: 482 SELLWLYKPVTRRPSKSFIHIIIKRNKTV 396 +E +W+ SF+H + +RNK V Sbjct: 113 AEKIWVPDTFFANDKNSFLHDVTERNKLV 141 >AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropin releasing hormone-binding protein protein. Length = 332 Score = 22.6 bits (46), Expect = 4.0 Identities = 10/23 (43%), Positives = 13/23 (56%), Gaps = 3/23 (13%) Frame = -2 Query: 372 YRDPS---GYLMISYLLKRPRPC 313 YR P G+ + + LK PRPC Sbjct: 173 YRIPKSGKGFSLFARFLKNPRPC 195 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 21.8 bits (44), Expect = 7.0 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = +1 Query: 79 ILGDRIRPNDVTISSDVSNSNYRHFWNLVQ 168 ILG+ + N S S +RHF +++ Sbjct: 380 ILGEDVENNSEVSKSRTKESAWRHFAAIIE 409 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 202,256 Number of Sequences: 438 Number of extensions: 4323 Number of successful extensions: 14 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23266665 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -