BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0835 (797 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 23 2.8 AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory recept... 23 2.8 AY052625-1|AAL15473.1| 135|Tribolium castaneum tryptophan oxyge... 22 6.5 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 22 6.5 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 22 6.5 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 23.0 bits (47), Expect = 2.8 Identities = 12/31 (38%), Positives = 21/31 (67%) Frame = -3 Query: 792 FFFLWTTKQVSKNSLVINKSPTSKY*LI*KI 700 FF+L +VSK+ +I+K T+++ +I KI Sbjct: 1029 FFYLVKFYKVSKSGELIHKIETNEHEIIDKI 1059 >AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory receptor candidate 1 protein. Length = 373 Score = 23.0 bits (47), Expect = 2.8 Identities = 12/31 (38%), Positives = 21/31 (67%) Frame = -3 Query: 792 FFFLWTTKQVSKNSLVINKSPTSKY*LI*KI 700 FF+L +VSK+ +I+K T+++ +I KI Sbjct: 310 FFYLVKFYKVSKSGELIHKIETNEHEIIDKI 340 >AY052625-1|AAL15473.1| 135|Tribolium castaneum tryptophan oxygenase protein. Length = 135 Score = 21.8 bits (44), Expect = 6.5 Identities = 13/47 (27%), Positives = 22/47 (46%) Frame = -1 Query: 410 IWIQQCTY*IMMFRALFSKMLKPQKNYSG*LYLQQIYGIFIVSVDTV 270 +W +Q Y + R +FS +L+ + L ++ I V VD V Sbjct: 3 LWFKQIIYELDSIRNIFSDVLEESQTLEILKRLNRVVLILKVLVDQV 49 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 21.8 bits (44), Expect = 6.5 Identities = 13/47 (27%), Positives = 22/47 (46%) Frame = -1 Query: 410 IWIQQCTY*IMMFRALFSKMLKPQKNYSG*LYLQQIYGIFIVSVDTV 270 +W +Q Y + R +FS +L+ + L ++ I V VD V Sbjct: 63 LWFKQIIYELDSIRNIFSDVLEESQTLEILKRLNRVVLILKVLVDQV 109 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 21.8 bits (44), Expect = 6.5 Identities = 13/47 (27%), Positives = 22/47 (46%) Frame = -1 Query: 410 IWIQQCTY*IMMFRALFSKMLKPQKNYSG*LYLQQIYGIFIVSVDTV 270 +W +Q Y + R +FS +L+ + L ++ I V VD V Sbjct: 63 LWFKQIIYELDSIRNIFSDVLEESQTLEILKRLNRVVLILKVLVDQV 109 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,555 Number of Sequences: 336 Number of extensions: 3538 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21687721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -