BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0835 (797 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF067613-9|AAN73863.2| 326|Caenorhabditis elegans Serpentine re... 29 5.1 U80837-2|AAB37902.1| 315|Caenorhabditis elegans Hypothetical pr... 28 8.9 >AF067613-9|AAN73863.2| 326|Caenorhabditis elegans Serpentine receptor, class z protein20 protein. Length = 326 Score = 28.7 bits (61), Expect = 5.1 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -1 Query: 575 KNVHYIFTIPFCFMTKTALIFLIGFYI 495 K VHY++ F F+TKT + F + Y+ Sbjct: 158 KRVHYLY---FAFITKTVIFFFVAMYM 181 >U80837-2|AAB37902.1| 315|Caenorhabditis elegans Hypothetical protein F07E5.2 protein. Length = 315 Score = 27.9 bits (59), Expect = 8.9 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = -1 Query: 314 LQQIYGIFIVSVDTVSNSISPLVKFSKQNIKFDFKLLTT 198 LQQ+ I ++S+ +SN++ +V +FD ++ TT Sbjct: 20 LQQMSPIGLISLSVLSNNMKQIVTMPNNKSRFDGRISTT 58 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,225,562 Number of Sequences: 27780 Number of extensions: 280132 Number of successful extensions: 507 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 493 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 507 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1945792630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -