BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0831 (832 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY345586-1|AAR09143.1| 427|Anopheles gambiae myosuppressin rece... 25 2.8 DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfat... 24 6.5 >AY345586-1|AAR09143.1| 427|Anopheles gambiae myosuppressin receptor protein. Length = 427 Score = 25.0 bits (52), Expect = 2.8 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = +2 Query: 131 REFCVLSKTLAEMLMSTDFCDIATLTKSLNVDM-NDVPLLMAVATTHTP 274 R++C +SKTLA + S C + L+ + ++V LL T TP Sbjct: 167 RQWCDMSKTLAAIFSSYVVCPFLAVPIYLSFSIQSNVELLGCDGNTLTP 215 >DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfatase precursor protein. Length = 525 Score = 23.8 bits (49), Expect = 6.5 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -1 Query: 256 YGH*QGNVIHVNVQRLRQ 203 YG+ GN I VN+ RL Q Sbjct: 47 YGYGDGNAITVNIDRLVQ 64 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 822,202 Number of Sequences: 2352 Number of extensions: 16088 Number of successful extensions: 29 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 87651612 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -