BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0831 (832 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z68316-2|CAA92681.1| 352|Caenorhabditis elegans Hypothetical pr... 29 4.1 Z67879-4|CAB54185.1| 297|Caenorhabditis elegans Hypothetical pr... 29 5.4 >Z68316-2|CAA92681.1| 352|Caenorhabditis elegans Hypothetical protein K08E4.3 protein. Length = 352 Score = 29.1 bits (62), Expect = 4.1 Identities = 16/46 (34%), Positives = 26/46 (56%) Frame = -3 Query: 599 LSIFQPSLTKSGLNFFLT*LNCHYCSYSYYDQICAKQGKNSAYKLA 462 L+ F P L++ G +F T C++ S YD I A G+ S++ L+ Sbjct: 189 LTSFNPRLSEGGCEWFGTAPLCNFPCPSDYDYIRANNGRCSSWWLS 234 >Z67879-4|CAB54185.1| 297|Caenorhabditis elegans Hypothetical protein C05E7.1 protein. Length = 297 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/47 (25%), Positives = 24/47 (51%) Frame = +2 Query: 401 HFVNITTALCISQEVLLLSHVLTCTRCFFLVSHIFGHNTSSYSNDNL 541 H + + C+ + + L + + T C L++ +FG ++ Y N NL Sbjct: 2 HIIPDSLFSCLDRSLSLRNRFVMITNCLILLAILFGFASTQYLNLNL 48 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,956,887 Number of Sequences: 27780 Number of extensions: 353700 Number of successful extensions: 889 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 861 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 888 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 2061488408 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -