BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0830 (597 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27527| Best HMM Match : MFAP1_C (HMM E-Value=0.57) 31 0.71 SB_26567| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 >SB_27527| Best HMM Match : MFAP1_C (HMM E-Value=0.57) Length = 818 Score = 31.1 bits (67), Expect = 0.71 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = -1 Query: 249 E*PIKPVRSVILDNNHSHNYIVAVHSFNNFKE 154 E P+K +R+ +L N+ + NY V HS NN E Sbjct: 455 ELPLKKLRTKLLKNDANDNYSVVGHSNNNLSE 486 >SB_26567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 28.7 bits (61), Expect = 3.8 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 372 NYRNTACTRWVSCFLRNTVARPPVAKGLNRLSNL 271 N RNT+C R C N R +A G+ ++S + Sbjct: 14 NQRNTSCDRHQDCSTHNASQRKSLATGIMQVSTM 47 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,357,841 Number of Sequences: 59808 Number of extensions: 279766 Number of successful extensions: 580 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 528 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 580 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1439498375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -