BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0830 (597 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF316637-1|AAG45165.1| 224|Anopheles gambiae glutathione S-tran... 26 1.1 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 24 3.2 AY028785-1|AAK32959.1| 509|Anopheles gambiae cytochrome P450 pr... 23 5.7 AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 23 9.9 >AF316637-1|AAG45165.1| 224|Anopheles gambiae glutathione S-transferase D8 protein. Length = 224 Score = 25.8 bits (54), Expect = 1.1 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = -1 Query: 486 YGLQYPLNTPGGL*VRPLSKQL*IIKTMMVINPFATSDN 370 Y L + TPGG + L + L ++ ++ NP+A N Sbjct: 114 YPLYFEGATPGGEKLEKLEEALAVLNGYLINNPYAAGPN 152 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 24.2 bits (50), Expect = 3.2 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = -1 Query: 99 VIRDPENYKDCYLKYTC 49 ++++ NY DCYL+ C Sbjct: 522 ILKEHPNYIDCYLRLGC 538 >AY028785-1|AAK32959.1| 509|Anopheles gambiae cytochrome P450 protein. Length = 509 Score = 23.4 bits (48), Expect = 5.7 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +2 Query: 239 IGHSYYEEVINKLLNLFNPFAT 304 +GH Y +V+N+ L + P T Sbjct: 361 MGHEYLGQVVNETLRKYPPLET 382 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 22.6 bits (46), Expect = 9.9 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -1 Query: 483 GLQYPLNTPGG 451 G +YPLNT GG Sbjct: 663 GQEYPLNTAGG 673 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 531,695 Number of Sequences: 2352 Number of extensions: 10412 Number of successful extensions: 13 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57609459 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -