BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0826 (838 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC18B11.11 ||SPAC1F5.01|GTPase activating protein |Schizosacch... 30 0.47 SPBC106.13 |||conserved eukaryotic protein|Schizosaccharomyces p... 28 1.4 SPAC5H10.03 |||phosphoglycerate mutase family|Schizosaccharomyce... 26 5.8 SPBC336.03 |efc25||exchange factor Cdc25p-like|Schizosaccharomyc... 26 7.6 >SPAC18B11.11 ||SPAC1F5.01|GTPase activating protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 1294 Score = 29.9 bits (64), Expect = 0.47 Identities = 14/59 (23%), Positives = 29/59 (49%) Frame = -3 Query: 395 LF*LIHSIEFYNF*MKFILYKLLLMICNVHLNTYCCSQSTYRLKTNIIKLGKIYKSLNN 219 +F L++ I Y +LY ++ ++C SQS ++ ++K Y++LN+ Sbjct: 208 VFSLLNCIISYGRISSAVLYSIVEVVCRAKFGLVASSQSAQQIVEKLLKTATKYEALNS 266 >SPBC106.13 |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 404 Score = 28.3 bits (60), Expect = 1.4 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 Query: 445 DYRLTEKFTEVLAWCRSDRAILK 513 D L ++ EVL+WC RAILK Sbjct: 163 DSILQQELKEVLSWCSEHRAILK 185 >SPAC5H10.03 |||phosphoglycerate mutase family|Schizosaccharomyces pombe|chr 1|||Manual Length = 219 Score = 26.2 bits (55), Expect = 5.8 Identities = 9/17 (52%), Positives = 15/17 (88%) Frame = +2 Query: 347 ISFKNCKTQYYELVKTS 397 +SFKNC+ + Y+LV+T+ Sbjct: 191 LSFKNCEFRIYDLVQTT 207 >SPBC336.03 |efc25||exchange factor Cdc25p-like|Schizosaccharomyces pombe|chr 2|||Manual Length = 987 Score = 25.8 bits (54), Expect = 7.6 Identities = 6/26 (23%), Positives = 17/26 (65%) Frame = +1 Query: 88 KNKLHINNCIVFFLMNCLINNAQHKS 165 +N ++ +NC ++++NC++ K+ Sbjct: 791 RNYINFSNCFTYWIINCILEKKNTKA 816 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,113,188 Number of Sequences: 5004 Number of extensions: 59463 Number of successful extensions: 145 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 145 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 145 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 412451140 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -